]> Achievement Stats » Profiles » Ullallulloo

Ullallulloo

Completion progress
Loading...
Rank 119041
Achievements 1736 (1107.47 points)
Number of games and DLCs 513
Number of all owning games 742
Badges 15 (2999 XP)
Member since April 01, 2011
Total playing time 2527.9 hours
Completion rate 2.0 %
Location Champaign, Illinois, United States

Show / hide summary

Achievements

Game # Unlocked achievements Locked achievements
Current best # Points % Next easiest # Points %
1000 Amps 10 0.7372966409Teleport 1 0.74 10 1.0415563583Light BoostSonarSpikesSuper JumpInfiniteVanquished1-1 9 10.05 90
View unlocking history of this single game only
The 39 Steps 20 -1 0 0.00 0 0.9021611810The Wrong DitchAn Unlikely VisitDeeper into this MessIn The SoupSanctuary of the InnThird Class CitizenGrave News 20 20.91 100
View unlocking history of this single game only
8BitMMO 24 1.4827603102Please hang up and try againGame Over 2 2.14 8.3 0.8049564362Reach Level 2Placer of BlocksReward FinderReach Level 3Dragon BuilderWhen you are Potato, anything is possible!Reward Scavenger 22 32.62 91.7
View unlocking history of this single game only
[Old Edition] Croixleur Sigma 45 -1 0 0.00 0 0.4058655500Fledgling ForagerBronze ShieldMonster SlayerGlorious TechniqueSilver ShieldNeophyteGentle Breeze 45 60.00 100
View unlocking history of this single game only
A Boy and His Blob 21 -1 0 0.00 0 1.0576241016Show some lovePassed the forestNovice Treasure HunterPassed the caveExperienced Treasure HunterPassed BloboloniaEnded the cave challenges 21 34.59 100
View unlocking history of this single game only
A Story About My Uncle 15 -1 0 0.00 0 1.0723518133Maddie's ChallengeSanctuary Grapple ChallengeSanctuary Perfect RunVillage Perfect RunFilled with WanderlustAll Collectibles Found"If he could do it, I could do it too" 15 24.69 100
View unlocking history of this single game only
A Valley Without Wind 98 1.9623030424Master BrawlerMore Than A Hole In The WallCheck Your Peripheral VisionSpelunking Without FlawAccomplished DegoonifierDo Ya Feel Lucky, Punk?Cave Ruckus 40 51.97 40.8 1.1462080479Bigger Than It Looked On The OutsideWatch That First Step!Weeee! I Can Fly!You Ain't Gotta Go Home, But You Can't Stay HereCaves Provide Such Nice ShadowsInner PerfectionHot Hot Hot! 58 125.53 59.2
View unlocking history of this single game only
A Valley Without Wind 2 210 -1 0 0.00 0 0.8360092640That's Where The Big Guy LivesInnocence Lost!It's Like A DocumentaryThere's More Work To Be DoneNine is Just FineWelcome to Environ!This Stuff is Pretty Good 210 396.90 100
View unlocking history of this single game only
A Virus Named TOM 44 -1 0 0.00 0 0.5251528025The Dog Days Are Over (SP)Leap Before You LookBeam Me Up (SP)HeliumOne Small Step For Man (SP)hotGirl365 (SP)Macaroni Chain 44 82.99 100
View unlocking history of this single game only
AaaaaAAaaaAAAaaAAAAaAAAAA!!! for the Awesome 10 -1 0 0.00 0 0.8339837193I am One in a Million, and There Are Six Thousand People in the World Exactly Like MeOne Fewer Than a Lewd Innuendo Because We Are Totally Past That PhaseI Have Come to The Point in My Life Where I Appreciate Christmas Mall MusicI Have Jumped Beyond the Powers of Two, and Have Lived to Tell the TaleI Have Broken More Glass Than a Finely Corpulent Opera Singer, and Love Myself For ItI am at Risk of Contracting Mononucleosis, Which is Known Colloquially as the Kissing DiseaseOooooOOoooOOOooOOOOoOOOOO!!! -- O Ooooooooo Ooooooooo ooo Ooooooo 10 14.43 100
View unlocking history of this single game only
ACE COMBAT™ ASSAULT HORIZON Enhanced Edition 50 -1 0 0.00 0 0.5626230240Critical HitBail OutGuns Guns GunsGun MasterMachine Gun FaithfulFire HazardLimbo 50 68.85 100
View unlocking history of this single game only
Age of Chivalry 33 -1 0 0.00 0 0.4576898515Seek and DestroyRoyal FlushChar BroiledFirst BloodAnimal Abuser!Elbow GreaseHeaven Can Wait 33 41.78 100
View unlocking history of this single game only
Age of Empires II (2013) 196 1.0169228315Protecting the PriestsPower of PersuasionAny OpponentLoyal AllyFoe of the KoreansFoe of the SaracensFoe of the Mayans 34 17.98 17.3 0.2909567058Foe of the BritonsFoe of the HunsFoe of the TurksLeave No Stone UnburnedGeneralCreation of your first Wonder of the WorldPhoenix Rising 162 253.32 82.7
View unlocking history of this single game only
Age of Empires II (2013): The African Kingdoms 31 0.2356208265Foe of the MaliansFoe of the Berbers 2 0.47 6.5 0.2203485966Foe of the EthiopiansFoe of the PortugueseMaster of the Medieval WorldConquerors Campaign CompletedEnemy of the EthiopiansTariq ibn Ziyad Campaign CompletedSundjata Campaign Completed 29 27.63 93.5
View unlocking history of this single game only
Age of Empires II (2013): The Forgotten 38 0.6487477422Foe of the IndiansFoe of the IncasFoe of the MagyarsFoe of the SlavsFoe of the Italians 5 3.17 13.2 1.2696835995Alaric Campaign CompletedEnemy of the ItaliansEnemy of the IncasDracula Campaign CompletedEnemy of the IndiansBari Campaign CompletedEnemy of the Slavs 33 50.02 86.8
View unlocking history of this single game only
Age of Mythology: Extended Edition 63 1.1791419983Ruler of AtlantisRuler of GoldRuler of the TridentRuler of Knowledge 4 4.11 6.3 0.7019745708Defeat the SoldierAnnihilationMaster of SupremacyRemember the FallenStone and SteelDefeat the SquadDemolition 59 88.35 93.7
View unlocking history of this single game only
Age of Mythology EX: Tale of the Dragon 7 0.1407798231Ruler of Dragons 1 0.14 14.3 0.2257449329Foe of Fu XiFoe of ShennongFoe of Nü WaCommander of Nü WaCommander of Fu XiCommander of Shennong 6 1.86 85.7
View unlocking history of this single game only
AI War: Fleet Command 322 -1 0 0.00 0 0.95251220461. Rainy Day Savings: 50,000 Energy5. Maxed Out Resources1. Warmup: 1 Hour Campaign1. Future Proofing: 150,000 EnergyHeat Wave Brown Out1. Control 2In The Midst Of A Cold, Dark Winter 322 730.19 100
View unlocking history of this single game only
AirMech 91 1.7360759974Guns Blazin'Power Play +2Called to DutyCreep KillerReplicators Failing!Kicking TiresTank Killer 26 26.07 28.6 0.7310555577On a RollWin 10 online MatchesMap Control (part 1)Replicators Down! (part 1)New Pair of ShoesDamage Inc.Fortress Assault (part 2) 65 104.60 71.4
View unlocking history of this single game only
Alan Wake 67 -1 0 0.00 0 0.2510778308Follow the LightLet There Be LightFloat Like a ButterflyNordic WalkingBright Falls' FinestUnder a Thin Layer of SkinPaging Mr. Wake 67 60.17 100
View unlocking history of this single game only
Alan Wake's American Nightmare 12 -1 0 0.00 0 0.6349183917Escape the Taken to the motel.Rewrite reality for the first time.Make sure Dr. Meadows can take another look at the skies.Rewrite reality for the last time.Take out two Splitter spawns with a single shot.Survive until dawn in any Arcade Mode level.Find all of the manuscript pages. 12 13.97 100
View unlocking history of this single game only
Alien Breed 2: Assault 13 -1 0 0.00 0 1.2608913183Deadly AssassinTime to PartyWar of AttritionOld SoldierVital StatisticsCash is KingPraemonitus Praemunitus 13 22.71 100
View unlocking history of this single game only
Alien Breed 3: Descent 13 -1 0 0.00 0 1.5805263519Time to PartyExterminatorBattle-hardenedThe InformedImmobilisedFrag-masterTank 13 24.67 100
View unlocking history of this single game only
Alien Swarm 66 -1 0 0.00 0 0.1593779325Technician SecuredHat TrickQuick and DeadShield DownQuick LoadProtect the TechSeal of Quality 66 57.73 100
View unlocking history of this single game only
Alien Zombie Megadeath 13 0.72561717035x MultiplierMy First SpacesuitBasic Training 3 2.06 23.1 0.920843422410x MultiplierGalaxy Explorer3 Million Total Score2 Million Individual ScoreUFOCleansed30 Million Total Score 10 16.80 76.9
View unlocking history of this single game only
Analogue: A Hate Story 14 1.0462498665Deep Space DetectiveTsunderAIFriendzone2 Girls, 1 CoreAbusive JerkMai WaifuForever Alone 11 8.77 78.6 0.9667900801Failure to PrioritizeRainbow ConnectionCrossdresser 3 3.04 21.4
View unlocking history of this single game only
Anodyne 6 -1 0 0.00 0 0.4114948511A ToolChangeA Meeting100% the game with 37 cardsLots of Cards100% the game under 3 hours 6 7.10 100
View unlocking history of this single game only
Anomaly 2 65 -1 0 0.00 0 0.8045279384First BloodTwo In OneDoomsday Weapon SpecialistGold StandardLittle CollectorArmor of SteelVR Is Overrated 65 118.28 100
View unlocking history of this single game only
Anomaly Warzone Earth 42 1.0890103579Blinded EnemyBaghdad SaviourEurekaThis Stuff Is GoodLittle CollectorFirst BloodGold Standard 8 5.57 19 1.1332956553The Suit Works FinePimp Your SquadMultitaskerTokyo SaviourTowerbaneFists of StoneEarth Saviour 34 53.56 81
View unlocking history of this single game only
Aquaria 27 -1 0 0.00 0 1.0814855099A New Chapter...Combo EaterPassed ThroughRomanceDance of the Forest SpritesSpirit BattleRock Crab Rocked 27 39.69 100
View unlocking history of this single game only
ARCADE GAME SERIES: DIG DUG 20 -1 0 0.00 0 0.7199496627Round 1 ClearedRound 2 ClearedSurface AssassinJust Passing ThroughCarrot2 EnemiesTurnip 20 26.02 100
View unlocking history of this single game only
ARCADE GAME SERIES: GALAGA 20 -1 0 0.00 0 0.8311150670ScorpionDual FighterStingrayEnemy FighterStage 10 ReachedDragonflyGalboss 20 31.21 100
View unlocking history of this single game only
ARCADE GAME SERIES: PAC-MAN 20 -1 0 0.00 0 0.7352325320CherryStrawberryRound 2 ClearedAll GhostsOrangeAppleRound 5 Cleared 20 28.09 100
View unlocking history of this single game only
ARK: Survival Evolved 31 -1 0 0.00 0 0.5287376642Your first day...Your first Dino...Your first Ride...Rex RiderMaximum SurvivorMaximum DinosaurGiga Rider 31 38.05 100
View unlocking history of this single game only
Astro Tripper 8 -1 0 0.00 0 0.8560800552Pod OppressorFly SwatterTank OppressorSpidery PointTank SympathizerWorm TangleWheel Collector 8 13.17 100
View unlocking history of this single game only
Atlas Reactor 121 -1 0 0.00 0 1.5104919672Massive AttackEye of the StormLevel 50CalculatedShield to the FaceMassive Attack - IIThe Power of Friendship 121 274.77 100
View unlocking history of this single game only
Atom Zombie Smasher 40 1.6406711340International Killing MachineThey LiveMultiplicityBig DipperTactical CamelidZed Industrial ComplexDog Days 17 12.69 42.5 0.5116963387KringleJammerFrom AboveStreet SweeperHow Fast They AreSnipe HuntMaximum OverrescueLlamas on Demand 23 31.03 57.5
View unlocking history of this single game only
Attractio 18 -1 0 0.00 0 1.4510447979Box RiderNew ToysBox Worst EnemyNot A Test ChamberCareful With The CameraGravity ShifterMortal Curiosity 18 39.15 100
View unlocking history of this single game only
Aurion: Legacy of the Kori-Odan 159 -1 0 0.00 0 1.2541733980Bantu WeddingLeoritas' DemiseDefender of ZamaBattle of Odane BridgeWall of the HeartExile from ZamaPrince's Ballad 159 345.55 100
View unlocking history of this single game only
Avadon: The Black Fortress 30 -1 0 0.00 0 0.9685102701Your New EmployerWall SpotsIrritable ReptileTested By FireShadow of the WoodsDon't Taunt DragonsAnvil Apprentice 30 58.61 100
View unlocking history of this single game only
AVSEQ 13 -1 0 0.00 0 0.7747057676Note MasterSafe Hands50 Notes100 NotesHalf way there10 Max50 Max 13 17.73 100
View unlocking history of this single game only
Awesomenauts 59 0.5480758548In pole positionThunder, thunder, thunder! 3Thunder, thunder, thunder! 2Awesomenauts, roll out!Hawk, wolf, puma and bear 1Knight of the magic light 1Yoooo JOE! 1 10 4.12 16.9 0.3348785341Croaked by a toadVenom is too slowSwimming in coins 1Knight of the magic light 2Hawk, wolf, puma and bear 2Let our powers combine!Robots fighting their shadows 49 61.86 83.1
View unlocking history of this single game only
Banished 36 -1 0 0.00 0 0.7762652636Smiles all AroundHealthyBuilderSettlementTraderFoodieBuilt from Stone 36 45.94 100
View unlocking history of this single game only
The Bard's Tale 51 -1 0 0.00 0 1.2826985121Thunder Spider TuneRodent's BaneDog WhispererSummon CaleighHeroine TuneBugbear SlayerChapter I 51 99.16 100
View unlocking history of this single game only
BARRIER X 7 -1 0 0.00 0 0.8891714215Let's start the journeyLet the Hunt Begin!Hmm, that was easy!Grand ExterminatorOne More TimeUnstoppableYOU ARE A MONSTER! 7 9.24 100
View unlocking history of this single game only
Bastion 24 1.2517468929A Lasting PeaceLock Yourself InWhatever's Out ThereAltruistMind VoyagerThe EndKid-at-Arms 14 9.91 58.3 0.7235375643The BeginningMan-at-ArmsCalamity KidTurret OperaJust Like ThatCalamity All AroundAll in the Mind 10 12.49 41.7
View unlocking history of this single game only
Batman: Arkham Asylum GOTY Edition 47 -1 0 0.00 0 0.3315683007Freeflow Combo 5Shocking RescueMalpractice Needs More PracticeLeave No Man BehindBorn FreeFreeflow Combo 10Arkham Analyst 47 36.89 100
View unlocking history of this single game only
Batman: Arkham City GOTY 64 -1 0 0.00 0 0.3364716768I'm BatmanAcid BathSaviorChimney SweepOne-Armed BanditArkham City SirensCommunication Breakdown 64 63.50 100
View unlocking history of this single game only
BattleBlock Theater 30 0.2644062042Secret FinderNail File CakeBlack MarketeerCast Member 4 0.76 13.3 0.2913668454Prison FoodVirtuosoTraitorDeadly PerformerConsolation PrizeSeasoned PerformerTake A Bow 26 24.93 86.7
View unlocking history of this single game only
Battleborn 60 -1 0 0.00 0 0.5566316843Dressed for SuccessDivide by Zero HourMister Wolf's Wild RidePerfectionistShock the TrooperGrow Forth and ConquerSolus Sentinel 60 97.84 100
View unlocking history of this single game only
Beast Boxing Turbo 19 -1 0 0.00 0 0.6133375764Boxing DebutTrain Hard, Fight HarderBush LeagueBaller!No Sweat!Pro LeagueSlab of Iron 19 17.98 100
View unlocking history of this single game only
Beat Hazard 25 0.4153191447Dude of HazardPwnageMuti MillionareHalf Way TherePerfectMillionare1st Track Cleared 8 2.44 32 0.3250812292x100The First HourGo PlatinumI'm Just StartingBrutal Boss KillElite!A Real Dare Devil 17 10.98 68
View unlocking history of this single game only
Beatbuddy: Tale of the Guardians 15 -1 0 0.00 0 0.9633181095Beatbuddy SwingSnare JumperLove SwingIn the RhythmMad on HealthLost In YesterdayDash Maniac 15 24.38 100
View unlocking history of this single game only
Beholder 38 -1 0 0.00 0 0.5229691863Not a Big DealerFamily GuyPimp My BrideDie Like You Mean ItWhite Papers, Black MailsI Choose ViolenceBilling Them Softly 38 49.58 100
View unlocking history of this single game only
Big Pharma 25 -1 0 0.00 0 0.4970389009TutoredIndebtedOver AnalysisHome RemediesCollided!The Headache ContradictionThe Blood Pressure Contradiction 25 40.92 100
View unlocking history of this single game only
BioShock 2 60 -1 0 0.00 0 0.8212479353Daddy's HomeDistance HackerProtectorUpgraded a WeaponAdopted a Little SisterSinclair's SolutionProlific Hacker 60 87.52 100
View unlocking history of this single game only
BioShock 2 Remastered 45 -1 0 0.00 6.7 0.9019995928Daddy's HomeDistance HackerProtectorUpgraded a WeaponAdopted a Little SisterSinclair's SolutionUnbreakable 45-3 60.07 100
View unlocking history of this single game only
BioShock Infinite 50 -1 0 0.00 0 0.1836574972Written in the CloudsWelcome to Monument IslandA Real PistolShock TacticsDress for SuccessFirst Class TicketDavid & Goliath 50 33.02 100
View unlocking history of this single game only
BioShock Remastered 65 -1 0 0.00 0 0.5137370229Toaster in the TubCompleted Welcome to RaptureOne Successful HackHacked a Security BotHacked a Vending MachineHacked a TurretHacked a Safe 65 75.08 100
View unlocking history of this single game only
BIT.TRIP BEAT 26 0.4056876302SUN.BATHINGJUGGLEREPIC.FAILOLD.SCHOOL.SKILLS 4 1.22 15.4 0.3148705363BIT.TRIPPERTRANSITION.COMPLETEJINGLE.BELLSCHALLENGE.COMPLETEMULTI.TASKERLONG.FALLDESCENT.COMPLETE 22 34.78 84.6
View unlocking history of this single game only
BIT.TRIP Presents... Runner2: Future Legend of Rhythm Alien 26 -1 0 0.00 0 0.3931705654First StepsBullseye!A New ChallengerOn Your WayCloud KingJogging AlongWho Dat!? 26 26.94 100
View unlocking history of this single game only
BIT.TRIP RUNNER 26 0.2927569151ROASTIN.MARSHMALLOWSBONUS.GETBIT.TRIPPERRAINBOW.POWER 4 0.82 15.4 0.2465079427EVERYONE.PLAYED BRAIDRUNNER.UPHEART.OF.GOLDLONGEST.JOURNEYIMPETUS.COMPLETEGONE.FISHINAMNESIA.MAKES YOU AFRAID 22 29.22 84.6
View unlocking history of this single game only
Blackwell Deception 18 -1 0 0.00 0 0.8235000372TeamworkGeromino!Key SnatcherOut of SightCheck out the CompetitionDumpster DiverTake my Card 18 17.00 100
View unlocking history of this single game only
Blade Symphony 26 -1 0 0.00 0 1.07975590230% Achievement PadawanTouchy FeelyInitiateBad SportsmanshipOrder Among ChaosTHIS IS SPARTA!Have a Seat 26 46.28 100
View unlocking history of this single game only
Bleed 32 0.6010266542Intrepid Explorer 1 0.60 3.1 0.6386401653Secret Mission 01: Gate CrasherStory Clear: EasyStory Clear: NormalS-Rank: GuppyS-Rank: White Mk IISecret Mission 03: Lil' MamaS-Rank: Battalion 31 43.37 96.9
View unlocking history of this single game only
Blocks That Matter 32 0.5444845557Tetrobot 1.0Bad RomancePut it in a jarSomeone did it wrong 4 1.65 12.5 0.4925904572I kissed a slime, and I liked itTetrobot’s fanclubTetrobot 1.1IJLOSTZBlocks EnthusiastHall of fameCitizen Game 28 37.03 87.5
View unlocking history of this single game only
Bloop Reloaded 11 -1 0 0.00 0 1.4889528751Happy DayForce PullerMeteor CollectorThe ThinkerMap CreatorMixerHalfway there 11 19.64 100
View unlocking history of this single game only
Boid 24 -1 0 0.00 0 0.8865486383StudentSurvivorVenomFriendly ExplosionStay CoolDead RobotCapped 24 49.13 100
View unlocking history of this single game only
Borderlands 2 50 0.7399727702Tribute To A Vault HunterSabre RattlerHigh-Flying HurlerWent Five RoundsUp High, Down LowCool Story, BroKnowing Is Half The Battle 31 10.48 62 0.4338907897Sugar DaddyCute LootUrban ExplorerFeels Like The First TimeCapped Out... For NowPhased and ConfusedGoliath, Meet David 19 16.19 38
View unlocking history of this single game only
Borderlands GOTY 50 0.8260339499Reckless AbandonMade in New HavenDestroyed the DestroyerWanted: FlyntDiscovered Eridian PromontoryDiscovered Crimson Lance EnclaveDestroyed the Hive 35 14.84 70 0.4335509837There's No "I" In "Team"United We StandAnd They'll Tell Two FriendsDuel-iciousTruly OutrageousDown in Front!Careful, He Bites 15 10.88 30
View unlocking history of this single game only
Borderlands DLC: Claptrap’s New Robot Revolution 10 0.7876018882Muerte la robo-luciónSteele-TrapNed-TrapKnoxx-Trap 4 3.13 40 0.8868416548It's so realistic!The CollectorTouristBobble-trapWhat a party!The Lubricator 6 6.87 60
View unlocking history of this single game only
Borderlands DLC: Mad Moxxi's Underdome Riot 5 -1 0 0.00 0 0.8697218895Small TournamentThe GullyHell-BurbiaThe Angelic RuinsBig Tournament 5 6.14 100
View unlocking history of this single game only
Borderlands DLC: The Secret Armory of General Knoxx 10 -1 0 0.00 0 0.5564294457Making a MonsterAthena, OutDepot DemolitionSpeed KillsDing! OverleveledDing! Overleveled to 11Sneaky Little Buggers 10 8.90 100
View unlocking history of this single game only
Borderlands DLC: The Zombie Island of Dr. Ned 5 -1 0 0.00 0 0.5270509124House of the NedJakobs FodderNed's Undead, BabyNight of the Living NedBraaaaaaaaaaaaains! 5 3.20 100
View unlocking history of this single game only
Bravada 48 -1 0 0.00 0 0.7864070535GluttonComboSlimesaur is defeated!ExplorerK.O.ScroogeGlutton 48 67.57 100
View unlocking history of this single game only
Brawlhalla 57 1.0724945068Let's Do This Again Next WeekFour's a PartyWelcome to Brawlhalla! 3 2.11 5.3 0.5839232206Just One More Game!See YaPractice Makes PerfectOur Powers CombinedJust Getting StartedTil KO Do Us PartCalm Before the Storm 54 70.00 94.7
View unlocking history of this single game only
The Bridge 20 -1 0 0.00 0 0.4807878137ThinkerAcademicScholarAftermath-InverterRunnerChallengerBridgewalker 20 21.89 100
View unlocking history of this single game only
Bridge Project 13 -1 0 0.00 0 0.8309152722Bridge ConstructorAdvanced Bridge ConstructorExpert Bridge ConstructorDrawbridge MasterBridge Farm's PrizeMaster Bridge ConstructorCanyons Master Prize 13 18.33 100
View unlocking history of this single game only
Broken Age 45 -1 0 0.00 0 0.8691823483Whoops!She's Doomed Us AllPlease Don't Tell AnyoneQuestion Your EldersMother and Child ReunionInhibitedSomething Not Light About Her 45 54.31 100
View unlocking history of this single game only
Brothers - A Tale of Two Sons 12 -1 0 0.00 0 0.5777792931Call of the giantsBunny BuddiesTurtle SoupWindpipeA sad tuneWishing WellWhale Song 12 8.91 100
View unlocking history of this single game only
The Bureau: XCOM Declassified 34 -1 0 0.00 0 0.6739519835All That RemainsDead HeadBringing down GoliathThe Last Suit You'll Ever WearIs He Old Enough to Drive?So Just Let Me Introduce MyselfAway Team 34 41.00 100
View unlocking history of this single game only
Call of Cthulhu: The Wasted Land 22 -1 0 0.00 0 1.0365400314Basic TrainingBattle WinnerThe RaidSuper RaiderThe Many  VoicesMany Many VoicesReanimate Slayer 22 34.95 100
View unlocking history of this single game only
Call of Juarez Gunslinger 26 -1 0 0.00 0 0.4018064439Keep At ItThis Time for RealDeath From AboveThere's More to ItFor Massive DamageStaying AfloatTrue Story 26 24.93 100
View unlocking history of this single game only
Capsized 18 -1 0 0.00 0 0.5957460999DieHardHidey-HoleFirst ImpressionsRookieEnsignXenocideCaptain 18 30.83 100
View unlocking history of this single game only
Cargo! - The quest for gravity 52 -1 0 0.00 0 0.59056502582012 - it’s almost thereHit The Road JackMy heart will go onLet the leaves hit the floorGet the party startedSuper Kicker 50Speeddeamon 52 65.54 100
View unlocking history of this single game only
Chariot 46 -1 0 0.00 0 0.7887384295SpelunkerStrange SouvenirsMight Come In HandyDeceased Parcel ServiceHoneymoonA Walk in the ParkOff to Adventure and All That! 46 99.39 100
View unlocking history of this single game only
Children of the Nile 16 -1 0 0.00 0 1.3298090696NekhenBubastisNubtGrand CampaignItjtawyMen-NeferIunu 16 28.44 100
View unlocking history of this single game only
Chime 15 0.3290379643The MusicianThe JugglerQuick Off the BlocksFairy Godmother 4 0.96 26.7 0.5731712580ComposerThe BeastJuggle MasterExplorerPiece of CakeBig BucksFast Mover 11 14.14 73.3
View unlocking history of this single game only
Chivalry: Medieval Warfare 49 0.8284795284Polearm UnlockedOne handed sharp UnlockedReach level 5 3 2.16 6.1 0.6519432664Two handed weapon UnlockedVultures ChefBastard weapon UnlockedReach level 10CupidTwo handed Axe UnlockedAll Two handed weapon Unlocked 46 58.09 93.9
View unlocking history of this single game only
Company of Heroes 2 378 -1 0 0.00 0 0.7397099137M.01 - German EngineeringCampaign ConscriptStalingrad Rail Station - ConscriptSenior PrivateComp-Stomp ConscriptM.01 - Compassion in WarStalingrad Rail Station - Captain 378 648.01 100
View unlocking history of this single game only
CONSORTIUM 2014 39 -1 0 0.00 0 1.1713563204Bishop 1, Mercs 0Who, Me?Hit the TurpsHe Chose... PoorlyWhat’s that Smell?Kill Me, Will You?!Longer Than Others! 39 77.72 100
View unlocking history of this single game only
Containment: The Zombie Puzzler 25 1.2084307671Boom! Headshot!Movie LoverZombie AssassinBuspocalypseOops!Vaccination into MutationZombie Butcher 9 7.24 36 0.9474450350Friendly FireGrande SurroundZombie MurdererEndangered SpeciesOh, the Humanity!George MeteskyWinnar! 16 19.96 64
View unlocking history of this single game only
Cortex Command 11 -1 0 0.00 0 0.6030616760Hello There!So That's What It's AboutTechnical WinAren't You CleverPyrrhic VictoryThese Guys Are Awesome!One Star General 11 15.93 100
View unlocking history of this single game only
Costume Quest 21 -1 0 0.00 0 0.4652200341Battle BudsLeave some for the rest of us!Downsized!Do the Monster BashDressed to QuestDozer DodgerMake it Work 21 16.66 100
View unlocking history of this single game only
Counter-Strike 2 1 -1 0 0.00 0 1.0089232922A New Beginning 1 1.01 100
View unlocking history of this single game only
Counter-Strike: Source 147 0.8553680182Gift GrabShrapnelproofThe CleanerKill One, Get One SpreeThe Unstoppable ForceSafety FirstHead Shred Redemption 11 4.06 7.5 0.2192597687Shot With Their Pants DownNewb World OrderWar BondsRepeat OffenderFinishing SchooledPrimerMagic Bullet 136 117.20 92.5
View unlocking history of this single game only
Crazy Taxi 12 -1 0 0.00 0 0.9927881956Arcade C-licenseOriginal C-licenseArcade B-licenseArcade A-licenseOriginal B-licenseArcade S-licenseOriginal A-license 12 16.99 100
View unlocking history of this single game only
CreaVures 21 -1 0 0.00 0 0.9080227613Be a Pokey-mon Mastera la MoteDollars and Essence-ntsIt's comin' right for us!Essence and SensibilitiesGoing through the Mote-tionsZappy, At Your Service 21 32.40 100
View unlocking history of this single game only
Crusader Kings II 32 1.9132282734Protector of the Holy PlacesUnited the KingdomsSaintDivine BloodIt's Better to be the EmperorKeeping it in the FamilyCelebrity 16 23.70 50 1.2803772688Until Death Do Us PartTurbulent PriestA Pope of My OwnMerchant PrinceOn English Neck a Norman YokeAll Three PopesCrusader King 16 29.59 50
View unlocking history of this single game only
Expansion - Crusader Kings II: Charlemagne 13 0.3738092184Not a Tribe 1 0.37 7.7 0.7227585912I Shed Blood of Saxon MenI'm Sorry, DesiderataRes PublicaHoly and RomanSeven CenturiesThe Frisian Coast is LongLittle Brother Rules! 12 11.52 92.3
View unlocking history of this single game only
Expansion - Crusader Kings II: Sons of Abraham 3 1.4377634525Kingdom of DavidPilgrim 2 2.16 66.7 1.6351776123The Black Bishop 1 1.64 33.3
View unlocking history of this single game only
Expansion - Crusader Kings II: The Old Gods 6 1.3047785759Persistent Survivor 1 1.30 16.7 0.7785077095New Ways for Old GodsViking RaiderThe One Who Brings BenefitHoly SmokeKhan of Khans 5 6.10 83.3
View unlocking history of this single game only
Cubemen 44 0.6971400976BLASTERCUBEISTSUPER SHOTTHUMPERMAESTROHUNTERCUBEISM 9 4.09 20.5 0.6123871803STOREMANMARKSMANCUBE MOGALIRONHIDESKIR-MAESTROQUATERMASTERSUPER BLASTER 35 48.56 79.5
View unlocking history of this single game only
Cubemen 2 59 -1 0 0.00 0 1.1511528492EARLY BIRDCROWD CONTROLSAMPLERLOOSE CHANGEOPEN SEASONTHE BESTSURPRISE! 59 124.13 100
View unlocking history of this single game only
DARK SOULS™: Prepare To Die Edition 41 0.4441347122Ring the Bell (Undead Church)Covenant: Way of WhiteReach LordranEstus FlaskEnkindle 5 1.65 12.2 0.5340483785Ring the Bell (Quelaag's Domain)Reach Anor LondoLordvesselRite of KindlingArt of AbysswalkingCovenant: Chaos ServantDefeat Seath the Scaleless 36 31.58 87.8
View unlocking history of this single game only
Darksiders 43 1.2961838245Legendary FormBalance RestoredYou Call That Easy?The Final ChallengerUltimate BladePayback's A B****Sight Beyond Sight 30 26.85 69.8 1.2061975002Wrath MachineDevastatorOpen Air ParkingAerial PredatorWorld RaiderFull PowerA True Horseman 13 19.60 30.2
View unlocking history of this single game only
Darksiders II 50 -1 0 0.00 4 0.3706118762Crow CarrionFire of the MountainLooks FamiliarPathfinderGrim ReapingTears of the MountainFeeding Time 50-2 49.91 100
View unlocking history of this single game only
Darksiders Warmastered Edition 43 -1 0 0.00 0 0.8084000945Death DealerTo Move A MountainPrison BreakChasm JumperReaperElemental ThiefLike A Bat Outta Hell 43 53.95 100
View unlocking history of this single game only
Data Jammers: FastForward 21 -1 0 0.00 0 0.8970938921Ducks In a RowGraduationBean CounterShining ArmorPacifistBreakoutPyromania 21 32.56 100
View unlocking history of this single game only
Day of Defeat: Source 54 -1 0 0.00 0 0.6900876164BeachheadAWOLDon't Bring a GunDon't Tread on MeGift GrabTrophy CollectorClean Sweep 54 71.57 100
View unlocking history of this single game only
Dead Pixels 30 0.6533553600Supply and demand 1 0.65 3.3 0.6997256875Bloodbath.Nice shot.Saving ammo.Ankle deep in the dead.It's a beginning.Master of all skills.Waist deep in the dead. 29 34.32 96.7
View unlocking history of this single game only
Dear Esther: Landmark Edition 10 -1 0 0.00 0 1.1933536530DonnelleySeonaidhJakobsonEstherPaulStac an ArminMan of the Rocks 10 13.58 100
View unlocking history of this single game only
DEFCON 22 1.5461763144Explore RussiaHit and runHad enough yet?Nice tryMerry Christmas 5 6.30 22.7 1.4325606823VictoryExplore AfricaExplore North AmericaExplore AsiaRecon expertExplore EuropeExplore South America 17 34.58 77.3
View unlocking history of this single game only
Defenders of Ardania 12 -1 0 0.00 0 0.7053111792RookieVacuum Cleaner AgentDemolition manMaster EconomistLibrarianCunningStraight Flush 12 20.84 100
View unlocking history of this single game only
Defense Grid: The Awakening 62 -1 0 0.00 0 0.1615914106First BloodHey! That's mine!Happy ReturnsField PromotionLeadheadEradicatorSurplus 62 38.38 100
View unlocking history of this single game only
Defense Grid: Resurgence Map Pack 1 1 -1 0 0.00 0 1.1746747494Combat Turmoil 1 1.17 100
View unlocking history of this single game only
Defense Grid: Resurgence Map Pack 2 1 -1 0 0.00 0 1.2468507290Circular Hazard 1 1.25 100
View unlocking history of this single game only
Defense Grid: Resurgence Map Pack 3 1 -1 0 0.00 0 1.2096138000Civil Divergence 1 1.21 100
View unlocking history of this single game only
Defense Grid: Resurgence Map Pack 4 2 -1 0 0.00 0 1.1932963133Regional DelugeOverflowing 2 2.54 100
View unlocking history of this single game only
Delve Deeper 50 1.1382902861The Quick and the DeadQuaintly QuixoticHe Chose... Poorly 3 2.88 6 0.6253370643The Eternal ConflictBy Royal DecreeIt Belongs in a Museum!The Pick and the DeadFriendly CompetitionAxe of the Great KingBank Bailout 47 75.21 94
View unlocking history of this single game only
Democracy 3 42 1.0704561472True PatriotEconomic MiracleFlip FlopsSurvivorElder StatesmanCabinet GovernmentBudget Balancer 18 10.75 42.9 0.3732061088Egalitarian MiracleDarwin's LegacyFilibusteringFull EmploymentTechnological SuperiorityEconomic StabilityDivisive Leader 24 28.60 57.1
View unlocking history of this single game only
DETOUR 26 -1 0 0.00 11.5 1.2999316454PliableThe Coffee! It Buuurns!!!Pardon Our Dust! And Then Eat It!88 MPHRigorousMine! Mine! Mine!Mystery Machine 26-3 47.32 100
View unlocking history of this single game only
Deus Ex: Human Revolution 49 0.7836663127The D ProjectTalion A.D.The FallLadies ManGood SoulAcquaintances ForgottenConsciousness is Over-rated 31 14.02 63.3 0.4688981771Bar TabCloak & DaggersThe Last StrawGuardian AngelThe ThrowdownDeus Ex MachinaBalls 18 16.09 36.7
View unlocking history of this single game only
Diehard Dungeon 69 -1 0 0.00 0 0.7954941988FighterFireproofRepelScatterHeartbreakerCourageKaboom 69 86.70 100
View unlocking history of this single game only
Dino D-Day 77 -1 0 0.00 0 0.6912233829I choose you!Give 'Em the BirdBite the Hand that Feeds YouPull!Hock a LugerYou Can't Go Home AgainExercise your options 77 113.48 100
View unlocking history of this single game only
DiRT 3 Complete Edition 60 0.4462553859Into the DiRT 1 0.45 1.7 0.5393255353Reputation BoostToday's Forecast is...Victory!Rising TalentDriving SchoolKick Off the Training Wheels!Watch the Paintwork!The Extra Mile 59 85.71 98.3
View unlocking history of this single game only
DiRT Showdown 49 -1 0 0.00 0 0.6431713104Welcome to the ShowDemolition!Mixed GrillJack of All TradesDon't Push MeCrash-Bang-Wallop - What a VideoPro 49 69.94 100
View unlocking history of this single game only
Dishonored 50 1.3079849482Mostly Flesh and SteelGhostShadowClean HandsSurgicalPoetic JusticeVanished 29 17.77 58 0.3561850786RogueCleanerCreepy CrawlyThe EscapistRazor RainDunwall in ChaosSpeed of Darkness 21 19.19 42
View unlocking history of this single game only
Dishonored - The Knife of Dunwall 10 0.4814867675Whisper WaysCleaner HandsWell ConnectedRedemptive PathStone Cold HeartMissing PiecesJust Business 7 1.68 70 0.2894894779No RegretsMessage from the EmpressRats and Ashes 3 1.50 30
View unlocking history of this single game only
Dishonored: The Brigmore Witches 10 0.0343308672Breakout 1 0.03 10 0.0497051254Parting ShotGangs of DunwallChanged WaysDeal MakerAll Come To RuinCleanest HandsSilence is Golden 9 3.10 90
View unlocking history of this single game only
DogFighter 29 -1 0 0.00 0 1.4628971815Runnin’ and Gunnin’RocketmanLive Long and ProsperPromotion: Lieutenant 2nd ClassSnake, RespondClean Me!Prospector 29 58.84 100
View unlocking history of this single game only
DOOM 39 -1 0 0.00 0 0.1065227166E1M1ButcherA Gift from BeyondInto the UnknownMomentum ShiftRip and TearTinkering 39 30.06 100
View unlocking history of this single game only
Door Kickers 43 -1 0 0.00 0 0.3697248101I'm doing itNow I have a machinegunEnough for a SparkI'm getting goodPersistence is keyThey can do itEvery life matters 43 49.79 100
View unlocking history of this single game only
The Dream Machine: Chapter 3 7 -1 0 0.00 0 1.6779210567Menial Labour'Blackmail Is Such An Ugly Word...'Among The Elite'I May Have Committed Some Light Arson...'End Chapter 3Two DownTend The Tender 7 11.91 100
View unlocking history of this single game only
Droid Assault 35 -1 0 0.00 0 0.4508411586Security 1Security 2Security 3Level 10Security 4TinkererRed Alert 35 42.45 100
View unlocking history of this single game only
Duet 76 -1 0 0.00 0 0.6687073112circular state of mindignorancespin classperseveredenialangerbargaining 76 128.43 100
View unlocking history of this single game only
Dungeon Defenders 78 0.3346821368Good Student 1 0.33 1.3 0.3767230511PupilSmithyFrom The DepthsDivine IntentionVeteranTo The RooftopsAnd This Is My Weapon 77 107.59 98.7
View unlocking history of this single game only
Dungeon Defenders II 18 -1 0 0.00 0 0.3406913579Defender InitiateForgot to HealDefense ProdigyVeteran DefenderBuster CannonTriggered My Trap CartShoots Da Fire 18 17.52 100
View unlocking history of this single game only
Dungeon Hearts 17 0.8340477347Quad TechBasic Training 2 1.33 11.8 0.8440273404Varmint HunterGrinding SpotMini BossCritical HitBeast BruiserMid BossNew Game Plus 15 22.35 88.2
View unlocking history of this single game only
Dungeons 2 25 -1 0 0.00 0 0.8175734282Little SnotUgh, Daylight!The King is Dead, Long Live the Evil!Cleaned out the Crystal ChamberStay and fight, you coward!Mine SuperintendentThe Last Unicorn 25 33.06 100
View unlocking history of this single game only
Dungeons of Dredmor 93 0.6854733229GesundheitI Smoulder With Generic RageNormandyThe Penitent Man Shall PassHe Chose... PoorlyHMS DeagleSuddenly The Dungeon Collapses 10 5.27 10.8 0.4825497568The Lake Wobegon AchievementGuess Who's Coming To Dinner?Welcome to DredmorIt's Dangerous to Go Alone! Make ThisBloody MessPlaying For Both TeamsPersonal Protection 83 110.91 89.2
View unlocking history of this single game only
Dungeons of Dredmor: Conquest of the Wizardlands 16 0.0096723977If Lost, Please Return to Wonkdonkler 1 0.01 6.3 0.3764164746Developers! Developers! Developers!The Magic of the Wizard's HangoverHell Is Other DigglesPaved With Good IntentionsStabbity Stabbity StabbityGolbez Is My New Master NowOrder of Lenin 15 17.17 93.8
View unlocking history of this single game only
Dust: An Elysian Tail 30 -1 0 0.00 0 0.2748602629Well on your WayPush and TurnWith Great Power...Distant ThunderBringer of DeathWait, aren't you...?A Decent Start... 30 21.28 100
View unlocking history of this single game only
Dustforce 1 -1 0 0.00 0 2.3662016392Double S+ 1 2.37 100
View unlocking history of this single game only
Dwarfs!? 29 -1 0 0.00 0 0.8573141694Stupid AchievementBronze AxeDiggy KongSilver AxeWar Is OnSharpshooterFor The Hoard 29 35.68 100
View unlocking history of this single game only
Dynamite Jack 13 0.9819130301Master of DarknessExpert MinerSpeed DemonCollectorTutorial Graduation 5 3.53 38.5 0.7829019427Mercy AwardSurvivalistBloodbathDemolition KingEscape ArtistPrison BreakPackrat 8 8.72 61.5
View unlocking history of this single game only
EDGE 47 0.6637114286Millimeter 1 0.66 2.1 0.7398650050SecondDropoffPickupLong FallCentimeterCompactSnowblind 46 67.22 97.9
View unlocking history of this single game only
The Elder Scrolls V: Skyrim 50 0.6252033710ReaderDelverSidewaysDragon HunterThe Eye of MagnusRevealing the UnseenHero of the People 15 5.29 30 0.0673381761UnboundBlessedBleak Falls BarrowThe Way of the VoiceGatekeeperCitizenTake Up Arms 35 16.49 70
View unlocking history of this single game only
The Elder Scrolls V: Skyrim - Dawnguard 10 -1 0 0.00 0 0.2934347689AwakeningBeyond DeathKindred JudgementA New YouSoul TearLost to the AgesAuriel's Bow 10 6.03 100
View unlocking history of this single game only
The Elder Scrolls V: Skyrim - Dragonborn 10 -1 0 0.00 0 0.2659365535OutlanderThe Temple of MiraakThe Path of KnowledgeAt the Summit of ApocryphaDragon AspectRaven Rock OwnerSolstheim Explorer 10 5.81 100
View unlocking history of this single game only
The Elder Scrolls V: Skyrim - Hearthfire 5 -1 0 0.00 0 0.3183021545LandownerProud ParentArchitectLand BaronMaster Architect 5 2.84 100
View unlocking history of this single game only
The Elder Scrolls V: Skyrim Special Edition 75 -1 0 0.00 0 0.2926164865UnboundBlessedApprenticeDragon SoulBleak Falls BarrowAdeptThe Way of the Voice 75 68.36 100
View unlocking history of this single game only
ENDLESS™ Legend 73 -1 0 0.00 0 0.2484926581Toe in the WaterBoot CampReal Estate MogulUrban SprawlPress the FleshStimulatedPheidippides 73 94.92 100
View unlocking history of this single game only
ENDLESS™ Space - Definitive Edition 79 -1 0 0.00 0 0.6474967003Ad Astra!Getting SchooledLean and MeanCultural AssimilationTrial and ErrorAlien & EveGraduation Day 79 138.14 100
View unlocking history of this single game only
ENSLAVED™: Odyssey to the West™ Premium Edition 58 -1 0 0.00 0 0.5083531141Free!SightseeingUp on the RoofInvincibleCaught a Show on BroadwayLover, Not a FighterEscaped New York 58 68.27 100
View unlocking history of this single game only
Ethan: Meteor Hunter 30 -1 0 0.00 0 1.0668256283Broken armI know the wayProblems?Power? What power?More! Still more!PyromaniacLittle by little 30 62.09 100
View unlocking history of this single game only
Eufloria 18 1.4529734850Attrition 1 1.45 5.6 0.8749431968MegatravellerBanzaiTravellerMartyrdomAggressorMinefieldBeseiged 17 23.41 94.4
View unlocking history of this single game only
Eufloria HD 20 -1 0 0.00 0 1.2788234949BanzaiIntruderTravellerUpliftBesiegedMinefieldMartyrdom 20 35.40 100
View unlocking history of this single game only
Europa Universalis IV 190 1.8732671738Turn the TableWorld DiscovererJust a Little PatienceMy armies are invincible!Truly Divine RulerIt's all about luckDefender of the Faith 18 14.15 9.5 0.7866669297The Princess is in this CastleRespectedBlockaderDouble the LoveRoyal AuthorityAggressive ExpanderDown Under 172 292.78 90.5
View unlocking history of this single game only
Expansion - Europa Universalis IV: Common Sense 25 0.3465551138This is My Faith 1 0.35 4 0.3425685763City of CitiesFull HouseVoting StreakBleed Them DryAll Your Trade Are Belong to UsOne Family to Rule them AllA Fine Goosestep 24 22.25 96
View unlocking history of this single game only
Expansion - Europa Universalis IV: Rights of Man 20 0.2906101346All That's Thine Shall Be MineCombined Arms 2 0.50 10 0.2348513007Gentle PersuasionQueen of ConquestAAA CreditNot just PizzaA tale of two FamiliesFanatic CollectivistWe bled for this 18 18.06 90
View unlocking history of this single game only
F.E.A.R. 3 50 -1 0 0.00 0 0.5225549936Prison ImpossibleGet To The ChopperPain, In BulkTown Hall BeatingThrough the HaystackTrouble CrossTerminal Victory 50 72.30 100
View unlocking history of this single game only
Face Noir 29 -1 0 0.00 100 50BirdwatchingA bit of OptimismPaper boyStrollers fallMLKHerman of MelvilleCall 911 29-29 0.00 100
View unlocking history of this single game only
Faerie Solitaire 30 0.4620696902Stage 1 ClearPerfectMy First PetSuper-ComboSupersonicSpeedster 6 2.27 20 0.5054423213HellfireQuick DrawMoney BagsStage 2 ClearUber-ComboPower TripWeedwacker 24 18.69 80
View unlocking history of this single game only
Fairy Bloom Freesia 50 -1 0 0.00 0 0.5456963778Guardian of Lita ForestPixie PugilistVengeful Tidal Wave of FistsAriel RaveNimble Little MinxA Fairy and a SadistCombat Pro 50 63.92 100
View unlocking history of this single game only
Fallen Enchantress: Legendary Heroes 54 -1 0 0.00 0 0.6532330513Built a CityMonster KillerRecruited an NPCDefeated an ArmyAdventurerExplorerExperienced 54 80.25 100
View unlocking history of this single game only
Fallout 4 50 -1 0 0.00 0 0.0935878456War Never ChangesBorn SurvivorWhen Freedom CallsCommonwealth CitizenFuture RetroThe First StepSanctuary 50 25.36 100
View unlocking history of this single game only
Fallout: New Vegas 50 1.0797941685The Courier Who Broke the BankKnow When to Fold ThemThe Whole Gang's HereLittle WheelTalent PoolNew Vegas SamuraiHack the Mojave 28 17.14 56 0.6889916062One Armed BanditYou'll Know It When It HappensReturn to SenderWild CardStim-ply AmazingNo Gods, No MastersLove the Bomb 22 23.07 44
View unlocking history of this single game only
Fallout New Vegas: Dead Money 5 0.8132618666Safety Deposit BoxCash OutHaving a BallSierra Souvenir AficionadoAssemble Your Crew 5 3.32 100 100 0 0.00 0
View unlocking history of this single game only
Fallout New Vegas: Honest Hearts 5 0.7478652596O Daughter of BabylonIn a Foreign LandRestore Our FortunesWhen We Remembered Zion 4 2.67 80 0.9426969290May my Hand Forget its Skill 1 0.94 20
View unlocking history of this single game only
Fallout New Vegas: Old World Blues 5 0.0988887548Making FriendsMake up your MindOutsmartedCardiac Arrest!Spinal-Tapped 5 0.37 100 100 0 0.00 0
View unlocking history of this single game only
Fallout New Vegas®: Gun Runners’ Arsenal™ 5 0.1347000599Master of the ArsenalCurios and Relics 2 0.20 40 0.6287289262Up to the ChallengeCombat VeteranPros Only 3 1.98 60
View unlocking history of this single game only
Fallout New Vegas®: Lonesome Road™ 5 0.2745762467Rocket's Red GlareCondemned to Repeat It 2 0.30 40 0.0648521259Hometown HeroED-EcatedWarhead Hunter 3 0.85 60
View unlocking history of this single game only
FEZ 12 0.8995969892Warp zoneAchievement unlockedEqual and oppositeGet a cube 4 2.39 33.3 0.7019628286Mightier than the swordCryptographerA numbers gameKill screenHaikus not epicsPhrenologistSum total 8 7.17 66.7
View unlocking history of this single game only
Fieldrunners 93 -1 0 0.00 0 0.6187975407Mow Them DownBlow 'em Up!Slow Mow!Mad ScientistWarming UpAerial SurvivalistBoot Camp Junior 93 163.40 100
View unlocking history of this single game only
Finding Teddy 19 -1 0 0.00 0 0.5951517820MonsteredWaspedBlobbedBzzzzMeowSpideredSnaked 19 16.13 100
View unlocking history of this single game only
Firefall 117 1.4873682261Diggin' on ThumpersColossal RemainsAssembly Line SlaughterGaea EnforcerExterminatorUnderground ResourcerOut of the Teens 12 13.55 22.2 0.8813527226It's Dangerous to go AloneTurn On The LightsClub ThumpingMe... Love... SHINY!Muck and MireScourge of the ChosenSorry, Gotta Run! 105-14 221.80 77.8
View unlocking history of this single game only
The Flame in the Flood 36 -1 0 0.00 0 1.0727789402Stay WarmPay It ForwardThe GreySnake CharmerI been everywhere, manHigh GroundPack Rat 36 68.52 100
View unlocking history of this single game only
FORCED 24 -1 0 0.00 0 0.6078910232Beat the Cow LevelStudent of PainSlice and Dice!High Voltage!BejeweledIt’s Hammer time!Mr. Ice Guy! 24 36.77 100
View unlocking history of this single game only
Fortix 2 26 -1 0 0.00 0 0.4101415873Square DealHappy DragonSuper ComboNo more to shootTriple HitThe ConquerorHarvester 26 26.14 100
View unlocking history of this single game only
Fractured Space 34 -1 0 0.00 0 1.3606312275BloodedCommittedTakedown MasteryDamage Rank 1Capture Mastery 10Starship Technician: USRStarship Technician: TDS 34 70.86 100
View unlocking history of this single game only
Free to Play 5 0.5162008405GG 1 0.52 20 0.5943036675MissingCareWell Played - FearWell Played - Dendi 4 2.54 80
View unlocking history of this single game only
Frozen Synapse 16 -1 0 0.00 0 0.4415051937True Focus Means Ignoring That Which is IrrelevantMaster of Clicking on StuffNow I Have A Machine Gun. Ho Ho Ho.Die in a FireBreaking the 4th WallThe Lament of the NoobIf at First You Don't Succeed, You Have Failed 16 20.37 100
View unlocking history of this single game only
Furi 33 -1 0 0.00 0 0.4150716066Kill the JailerSo FreshA Prison within a PrisonLight It UpPerfect ParrierLet's BrawlGive It a Real Try 33 35.14 100
View unlocking history of this single game only
Galactic Civilizations III 45 -1 0 0.00 0 0.5954738855Our New HomeWarriorAliens?!?!GreedyNew RecruitDanger ZoneFlying in Style 45 78.46 100
View unlocking history of this single game only
GALAK-Z 35 -1 0 0.00 0 0.7648757100Don't Mind MeGolden WingsDarkest Before DawnVariable FighterThat Would Be StealingMy Shields Are Blown!Treasure Hunter 35 82.64 100
View unlocking history of this single game only
Garry's Mod 29 -1 0 0.00 0 0.0850559175Play MultiplayerPlay AroundPlay SingleplayerBad CoderMap LoaderOne DayProcreator 29 26.83 100
View unlocking history of this single game only
Gemini Rue 15 -1 0 0.00 0 0.8891152143DiplomacyGeminisGive me a Hard CopyRue the DayStair masterGood SamaritanMemories 15 20.36 100
View unlocking history of this single game only
Giana Sisters: Twisted Dreams 25 -1 0 0.00 0 0.4483279884Dream TwistRuby-Red PirouetteCitrine CannonballA Flurry of FeathersA Brush With DeathSoft LandingShell Shock 25 43.35 100
View unlocking history of this single game only
Goat Simulator 49 -1 0 0.00 0 0.2713584602FINALLYGoat QueenWhat is its purpose?DemogoatAlexander GoatstafssonAngel GoatStand by for Goatfall 49 40.17 100
View unlocking history of this single game only
GoD Factory: Wingmen 46 -1 0 0.00 0 0.9599423409Know HowSolo ComboThe Best Offence is a Good Defense!Boom!OptimizerUnder...dog...fight?Hide & Seek 46 87.67 100
View unlocking history of this single game only
God Mode 24 -1 0 0.00 0 0.3822908103The HunterBorn a LegendBadtriggerfingerNothing SafeHand of DoomDeathboundThem Bones 24 28.35 100
View unlocking history of this single game only
Goodbye Deponia 50 -1 0 0.00 0 0.8164216280Huzzah – good things come in threesLudicrous SpeedHuzzah – with helium gasFree ToffeeHuzzah - because brakes are for wimpsCaffeine CrackieHuzzah – he completely f*cked up 50 50.93 100
View unlocking history of this single game only
Gravi 26 -1 0 0.00 0 0.8412019014Collectible KidGrav-I Will Survive!Chapter 1: Big Deal!Perseverance PaysChapter 2: No Sweat!Collectible ConnoisseurWho Goes There? 26 57.53 100
View unlocking history of this single game only
Greed Corp 13 -1 0 0.00 0 0.7183311582Walking in a winter wonderlandLost in the WaveIsland of DoomWith Cannon, you canDaylight SavingGlobal WarfareFear of Flying 13 24.17 100
View unlocking history of this single game only
Grey Goo 35 1.2425918579Self SacrificeStart of Something Epic 2 2.14 22.9 1.1119283438No More RunningPractice Makes PerfectPoint of First ContactEpic EscalationCall for HelpEnd of the BeginningMaxed Out! 33-6 71.14 77.1
View unlocking history of this single game only
Grim Fandango Remastered 47 -1 0 0.00 0 0.5826435089"What I did back in the fat days is none of your business. You know the rules.""Lousy bony fingers!""I squeezed down one of these tubes, like a pixie!""Gets the aggressions out, doesn't it?""Well, I could do something bad right now if that would help.""Join or Die! Again!""Precisamente, amigo." 47 44.94 100
View unlocking history of this single game only
Grow Home 26 -1 0 0.00 0 0.4828455746Where's Warble?What, no zombies?Houston, we have a solutionRedcow RobotVenus in fursUnderground, OvergroundGreen Fingers 26 26.09 100
View unlocking history of this single game only
Guacamelee! Gold Edition 60 1.2386347055I swat youPoncho'd OutDeliciousGumshoeBoom-Shack-CalacaMusic to my earsStop squirming 34 24.11 56.7 0.7352017760Combo NerdNooks and CranniesGreen ThumbI AM ERRORWhich came first?Cleaned OutBag o' bricks 26 34.81 43.3
View unlocking history of this single game only
Guardians of Middle-earth 29 -1 0 0.00 0 1.2471562624Honor in DeathRule Them AllRise to the TopUltimate VengeanceSeasonedMaster MasonFoe's Bane 29 67.14 100
View unlocking history of this single game only
Guild of Dungeoneering Ultimate Edition 63 -1 0 0.00 0 0.4184679687A Chump Will DoI Ain't Sayin You're A GravediggerTrophy LifeNOOOOOoooooPacifistQuicker Than TheeOi! You What?! 63 86.29 100
View unlocking history of this single game only
Gun Monkeys 8 0.9230935574Monkey Fever 1 0.92 12.5 0.8556178808Prime MateStill AliveCheeky MonkeyWinning Streak!CocktailFly, Monkey, Fly!Masochist 7 8.75 87.5
View unlocking history of this single game only
Gunman Clive 9 -1 0 0.00 0 1.0692152977The EndFeministFor the birdsNo Damage!One CreditA bird in the handSpeed runner 9 15.47 100
View unlocking history of this single game only
Gunpoint 42 -1 0 0.00 0 0.3262710869GhostDingShort CircuitCat BurglarSo This Is Why People Don't Like MeOpen Door PolicyGentleman 42 28.28 100
View unlocking history of this single game only
Guns of Icarus Online 849 1.3185751438Sound the AlarmLittle HelpersCool Under FireDamage ControlOn DeckFar-seerBody Work 13 10.27 1.5 0.9803293347In the BuffWax OnReady To FlyDemonstration PurposesTake CoverReporting for DutyHelping Hand 836 2533.01 98.5
View unlocking history of this single game only
Hack, Slash, Loot 18 -1 0 0.00 0 0.6059542894Wooden SpoonLoveable RogueBloodthirstyBackstabberTurtleBowmasterSwordsmith 18 30.45 100
View unlocking history of this single game only
Hacker Evolution Duality 9 -1 0 0.00 0 1.1390496492n00b100 firewalls bypassed100 servers hacked31337100 D.O.S attacks launched100 EMP attacks launched100 VOICEPRINT passwords cracked 9 16.46 100
View unlocking history of this single game only
Half-Life 2 33 -1 0 0.00 0 0.2658176720MalcontentTrusty HardwareAnchor's Aweigh!Heavy WeaponsRevenge!SubmissiveZero-Point Energy 33 20.68 100
View unlocking history of this single game only
Half-Life 2: Episode One 13 -1 0 0.00 0 0.5471431017Watch Your Head!ContainmentElevator ActionAttica!Escape From City 17Citizen EscortLive Bait 13 10.42 100
View unlocking history of this single game only
Half-Life 2: Episode Two 23 -1 0 0.00 0 0.4474675059Acid ReflexInto the BreachTwoferMeet the HuntersGunishment!Deadly HarvestQuiet Mountain Getaway 23 17.46 100
View unlocking history of this single game only
Halo: Spartan Assault 25 -1 0 0.00 0 0.3181044161RecruitEscort ServiceProdigyOverrunSkull ComboSwitched OnSwitched Off 25 29.23 100
View unlocking history of this single game only
Hammerwatch 38 -1 0 0.00 0 0.4653481245Mass murderAffluentThe QueenThe Grisly CombinationThe KnightRichHarvesting 38 54.89 100
View unlocking history of this single game only
Happy Wars 36 -1 0 0.00 100 0.4363210499First VictorySpin Spin SpinnerNobody Calls Me NoobThe Legend BeginsTreasure HunterMOD 0BOT Hunter 36-36 58.31 100
View unlocking history of this single game only
Hard Reset 81 1.6004272699Mechanic (Tier: Hard)Patient (Tier: Hard)No Bananas Today (Tier: Hard)Pissed Off (Tier: Hard)Mechanic (Tier: Normal)KillerPatient (Tier: Normal) 23 21.41 28.4 0.5735842586Retirement (Tier: Easy)Retirement (Tier: Normal)Monkey Business (Tier: Easy)Monkey Business (Tier: Normal)Overkill (Tier: Easy)Boredom No More (Tier: Easy)Power Down (Tier: Easy) 58 89.07 71.6
View unlocking history of this single game only
Hard Reset: Exile DLC 34 -1 0 0.00 0 1.2551994324Exile: Pest Control (Tier: Easy)Exile: Deconstruction (Tier: Easy)Exile: Fugitive (Tier: Easy)Exile: Cop Killer (Tier: Easy)Exile: Bug Splatter (Tier: Easy)Exile: WandererExile: Pest Control (Tier: Normal) 34 59.01 100
View unlocking history of this single game only
Hero Academy 40 0.4355262816Learned Something 1 0.44 2.5 0.5971992612Frozen LakeMatrix GlitchNap TimeJust One More TurnBring it On!Ow! My Jewels!Take All Day Academy 39 45.51 97.5
View unlocking history of this single game only
Hexcells 6 -1 0 0.00 0 0.2757725716World 2World 3World 4World 5World 6Perfectionist 6 1.94 100
View unlocking history of this single game only
Hexcells Infinite 7 -1 0 0.00 0 0.3662213087World 2World 3World 4World 5World 6Perfectionist60 down 99,999,940 to go 7 3.30 100
View unlocking history of this single game only
Hexcells Plus 6 -1 0 0.00 0 0.3899185061World 2World 3World 4World 5World 6Perfectionist 6 2.73 100
View unlocking history of this single game only
HOARD 118 -1 0 0.00 0 0.4607561529Red HandedMoney in the BankOverthrowMy TurfBurnt Bread ICivil Unrest IBrick by Brick I 118 173.72 100
View unlocking history of this single game only
Homefront 47 -1 0 0.00 0 0.6114195585ChroniclerWhy We FightFreedomFire SaleThe WallHeartlandOverwatch 47 66.92 100
View unlocking history of this single game only
Hotline Miami 35 0.4240152538Combo ProNigel LowrieCombo IntermediatePlaying PoolCombo Beginner 5 1.28 14.3 0.2620847225Domino EffectAced ItDog Lover1989The End?That's It?Let In Some Air 30 25.70 85.7
View unlocking history of this single game only
Human Fall Flat 127 -1 0 0.00 0 0.0969358906No escapeTouristClimberLeap of FailChoo Choo!Don't Get a Splinter!What Goes Up 127 167.59 100
View unlocking history of this single game only
Human Resource Machine 16 -1 0 0.00 0 0.3423867226Career Milestone 1Career Milestone 2Career Milestone 3Glorious Failure: Solution Not RobustOrange Optimization AwardKing of VerbosityCareer Milestone 4 16 12.55 100
View unlocking history of this single game only
I Am Bread 35 1.4354803562All Buttered UpYou Jelly?The Walking BreadBready for AnythingBunfortunateI Am Dead 6 5.82 17.1 0.9552674294The Bread BaronTV DinnerPicky EaterRye and DryBagel Space Program"Party's Over!"The End is Rye 29 53.61 82.9
View unlocking history of this single game only
iBomber Defense Pacific 25 0.7536589503Basic Training 1 0.75 4 0.8511734009GunslingerFlying FortressSgt. MajorLone StarGeronimoCaptainSuperfortress 24 34.36 96
View unlocking history of this single game only
Impire 48 -1 0 0.00 0 0.7491610050UnstoppableButcherPillagerRequisitionA new friendAnd so it beginsPlunderer 48 98.74 100
View unlocking history of this single game only
The Incredible Adventures of Van Helsing II 63 -1 0 0.00 0 0.9176954627End of the beginningUnshackled GeniusLegacy of the FoolMirelite MiracleForbidden pathMasterfully Botched GiftShock and Awe 63 100.77 100
View unlocking history of this single game only
The Incredible Adventures of Van Helsing: Final Cut 50 -1 0 0.00 0 0.6281059384ManservantLet loose the ghost of warReach BorgovaTreasure HunterMonsters' BaneTower DefenderBreda and Butter 50 77.14 100
View unlocking history of this single game only
Incredipede 6 -1 0 0.00 0 0.8156880140Explore OutsideRunning LegsFear of the UnknownClose EncounterSpider SecretsDo Feed The Animals 6 4.97 100
View unlocking history of this single game only
Infested Planet 36 -1 0 0.00 0 0.4948185682Opening GambitsWarpathArsenalFoundationsBlitzkriegCrow's NeckScience Station 36 36.47 100
View unlocking history of this single game only
Infinifactory 22 -1 0 0.00 0 0.5282829404Job SecurityFlat-pack FactoryOptimization (Training Routine 1)Optimization (Training Routine 5)Optimization (Wave Detection Array)Optimization (Guided Javelin Type 1)Power Couple 22 31.89 100
View unlocking history of this single game only
Intrusion 2 14 -1 0 0.00 0 0.6498531103PlumbingGrabberMaku and DanFish foodSmashGiant faceFly trap 14 22.13 100
View unlocking history of this single game only
Jack Lumber 27 -1 0 0.00 0 0.9269746542Flapjacks consumed!Spruce things upWooden NickelsPlay it again, SamLumber StubbleBropaw!Credit where credit is due 27 39.62 100
View unlocking history of this single game only
Jamestown 42 0.2462450117Mission Accomplished!SoloTyrannicide 3 0.71 7.1 0.2691951394Welcome Home...Buy, Buy, Buy!LadykillerTrial By FireWith Your Nose So Bright...JailbreakNormal Combo 39 53.96 92.9
View unlocking history of this single game only
Jet Set Radio 30 -1 0 0.00 0 0.6017870307Feel the BeatWe got us a crewI Need a ParachutePublic MenaceLook BehindRemixes Suck!Unlock Garam 30 53.79 100
View unlocking history of this single game only
Joe Danger 2: The Movie 30 -1 0 0.00 0 0.5561748147First Day on Set!Quick Change!Winter is Coming!Rising Star!I AM the Law!Spring Roll!Talent Spotter! 30 51.62 100
View unlocking history of this single game only
Jolly Rover 16 1.1182969809Skull CrackerBallooningClown PirateTurtle SteedTreasure!Captain RoverMasquerade 11 10.33 68.8 1.2001694441Adventure GamerFlag WaverCoin CollectorCracker PackerMaximum Score 5 6.70 31.3
View unlocking history of this single game only
Jotun: Valhalla Edition 36 -1 0 0.00 0 0.9384014010Tame the WildsDefeat the DarknessConquer the ColdWeather the StormShun the Gods - JeraBrave the InfernoValhalla Awaits 36 68.89 100
View unlocking history of this single game only
KHOLAT 20 -1 0 0.00 0 0.9112060070Circle of lifeWhat is he?The runnerSacrificedThere is no hopeIn the name of the FatherStrange lights in the sky 20 29.53 100
View unlocking history of this single game only
Killing Floor 285 -1 0 0.00 0.4 0.2376583368ExperimenticenticideIt's Not Easy Being GreasySocial OutburstTrick, not TreatA Bloody Christmas CarolExperimentimillicideStraight Rush 285-1 362.60 100
View unlocking history of this single game only
Killing Floor Mod: Defence Alliance 2 30 -1 0 0.00 0 2.7984282970Lucky damageClot ChampionSetup the defenceAlliance 1 - 0 ZombiesBloat ChampionGorefast ChampionYou're a teamplayer 30 85.55 100
View unlocking history of this single game only
Kingdom Wars 35 -1 0 0.00 0 0.8738203645Building A FutureMilitary Industrial ComplexHome Sweet HomeHumble BeginningsSupersizedLeaving the NestHardwood 35 61.76 100
View unlocking history of this single game only
Knights of Pen and Paper +1 42 -1 0 0.00 0 0.4177846313Elite KillLevel 5LuckyUnluckyTough Battle!Blacksmith Level Up!Hit That Vein 42 41.94 100
View unlocking history of this single game only
Kung Fu Strike: The Warrior's Rise 12 -1 0 0.00 0 0.5552730560Air-dancerBeginningEnhancementDuoShopperBreakerNew Journey 12 17.10 100
View unlocking history of this single game only
Larva Mortus 25 -1 0 0.00 0 1.3098767996WEREWOLF'S CLAWBLOODY MANACLESSACRED CUPBACKPACKDEMON'S BLOODCURSED NAILVOODOO DOLL 25 33.06 100
View unlocking history of this single game only
Left 4 Dead 73 -1 0 0.00 0 0.3384700716DRAG AND DROPTONGUE TWISTERTANKBUSTERSBRAIN SALADBLIND LUCKPYROTECHNICIANTOWERING INFERNO 73 60.74 100
View unlocking history of this single game only
Left 4 Dead 2 101 1.2395212650GOOD GUY NICKLEVEL A CHARGEGONG SHOWSTACHE WHACKERGUARDIN' GNOMECL0WNDGHOST OF CHRISTMAS PRESENT 19 10.92 18.8 0.3237742484CRASS MENAGERIEMIDNIGHT RIDERGREAT EXPECTORATIONSWEATHERMANQUALIFIED RIDEBRIDGE BURNERRAGIN' CAJUN 82 93.95 81.2
View unlocking history of this single game only
Legend of Grimrock 40 0.9642469883SlimedMaster WizardSecret SpotterSwordsmanApprentice Wizard 5 3.57 12.5 0.7203813195I Use Gravity As a WeaponApprentice AlchemistOgre SlayerGo the Extra MilePitfallSecret SnifferMonster Killer 35 41.46 87.5
View unlocking history of this single game only
Legend of Grimrock 2 60 -1 0 0.00 0 0.6503733993Apprentice WizardExtreme GardeningSwordsmanElementaryApprentice AlchemistExplorerSecret Spotter 60 73.47 100
View unlocking history of this single game only
Legends of Eisenwald 45 -1 0 0.00 0 0.9663973451Knowledge is powerDog's stashI don't recognize you, YorickHumble LionAbbot's belovedThis is my prey!Hunt for cynocephalus 45 84.00 100
View unlocking history of this single game only
Lethal League 23 -1 0 0.00 0 0.4412074089Rifle StrikeBats In The DarkDouble PlayChrono WarpLethal RivalsClutchRookie Player 23 29.89 100
View unlocking history of this single game only
Lightfish 18 -1 0 0.00 0 0.6223597527Cabin boyEmpoweredFresh fishSlipperyAll starShallow waters masterCatch-and-release 18 18.40 100
View unlocking history of this single game only
The Long Dark 56 -1 0 0.00 0 0.4650023580Your Journey BeginsThe First of ManyParadise LostThe Long WinterNight WalkerLeaving the Old World BehindLosing a Child is Like... 56 82.64 100
View unlocking history of this single game only
The Lord of the Rings: War in the North 46 -1 0 0.00 0 0.4600204527Friend to the EaglesSudden FuryElf-friendWhere there's life, there's hopeFoe-hammerFell-handedTharzog's Bane 46 45.92 100
View unlocking history of this single game only
Lost Planet 3 50 -1 0 0.00 0 0.7332572937Helping HandLost LogRolling OutTo the RescueEmpty NestSaving the DayArmed and Dangerous 50 80.38 100
View unlocking history of this single game only
Lovers in a Dangerous Spacetime 28 -1 0 0.00 0 0.3529516757Romantic GetawaySeat WarmerFirst DateGenerosityBear-Knuckle BoxingWave GoodbyeClearing the Air 28 37.54 100
View unlocking history of this single game only
Lucid 11 0.4913144410LUCID_EARTH 1 0.49 9.1 0.5974664688PICNIC_ON_THE_MOONYELLOW_STARBLUE_SKIESSOMEWHERE_OVER_THE_RAINBOWDARK_SIDE_OF_THE_MOONGREEN_SUNRED_SUPERGIANT 10 9.67 90.9
View unlocking history of this single game only
LUFTRAUSERS 12 -1 0 0.00 0 0.2853992879SMALL SCIENCEAIR SUPERIORITYSEA SUPERIORITYUNDERWATER SUPERIORITYBIG SCIENCESERIOUSLY, DONT MESS WITH THE RAUSERYOU WERE RAISED 12 9.20 100
View unlocking history of this single game only
MacGuffin's Curse 15 -1 0 0.00 0 0.6378826499Sneaky ThiefJunkyard DogHonourary MayorFixatedSleuthGet With the TimesPostal Hassler 15 19.86 100
View unlocking history of this single game only
Machinarium 12 -1 0 0.00 0 0.7882611752SURVIVORBACK IN TOWNFREE ROBOTPET CATCHERBOARD GAME MASTERMUSIC LOVERPLUMBER 12 11.36 100
View unlocking history of this single game only
Mafia II (Classic) 47 -1 0 0.00 0 0.2492373586Viva la Resistenza!Big BrotherBack in BusinessHome Sweet HomeHe Who Pays the BarberTuned RideCollector's Item 47 28.94 100
View unlocking history of this single game only
Magicka 52 -1 0 0.00 0 0.1459418386State AlchemistBasic ElementCooking by the bookAn eye for an eyeNo more trollingLet off some steamHoudini 52 39.21 100
View unlocking history of this single game only
Major Mayhem 100 -1 0 0.00 0 0.8139083982Bunny HopMode MadAnvil of JusticeAvid GamerSharing is CaringPowered UpPistolero 100 153.34 100
View unlocking history of this single game only
Mare Nostrum 26 -1 0 0.00 0 2.6888298988SunburnKnight's CrossWaltzing MatildaInfantry Assault BadgeQueen of the DesertMotorbrokeAfrica Star 26 87.36 100
View unlocking history of this single game only
Mark of the Ninja 30 0.7601667643MercyTricksterStealth AssassinAwakenedHisomu's Heir 5 1.92 16.7 0.4315885603SnareThe MercenaryThe Worst AlliesMasterfulThings Better Left UnseenCrimson HaikuNo One Lives Forever 25 21.56 83.3
View unlocking history of this single game only
MASSIVE CHALICE 28 -1 0 0.00 0 0.6767593622Keep DefendingMatchmaker MatchmakerBABIES!Graduation DaySage, right?Golden AnniversaryThe Standard of Excellence 28 43.50 100
View unlocking history of this single game only
Mechanic Escape 33 -1 0 0.00 0 0.9988305569LocustTenaciousRookie riderDaredevilMonkeyTirelessFrog 33 47.29 100
View unlocking history of this single game only
MechWarrior Online 25 1.3465011120PhilanthropistA Moderate GiverCreeping DeathBreakin'Pyrrhic VictoryShare the LoveHat-Trick! 10 9.37 40 0.4836500585Basic Tutorial CompleteLess Green, More MeanJohnny FiveSeriously!?H-H-Headshot!Big Brother/SisterGiant Helper 15 21.04 60
View unlocking history of this single game only
Megabyte Punch 30 2.0224752426UP for a challenge!Ancient HeightsBouncy Bounce HouseIcessassinated!Subprogrammed!500 Enemies downNo more Grand Khotep... 10 15.38 33.3 1.6858104467I believe I can jumpDown again!Is it over?Pelvic ThrusterThree FlowersMEGABYTE PUUNNCHHHH!1000 Enemies down 20 40.72 66.7
View unlocking history of this single game only
Mercenary Kings 26 -1 0 0.00 0 0.8695227504ExecutionerDenied!UntouchableHoarderBaron BashingFavoritePoacher 26 45.93 100
View unlocking history of this single game only
Merchants of Kaidan 22 -1 0 0.00 0 1.6659429073Double moneyReal moneyLuckyGadgeteerJinxJewellerMonster Slayer 22 45.20 100
View unlocking history of this single game only
Metro 2033 48 -1 0 0.00 0 0.3569642305First bloodNosalis hunterDemolitionistTank BusterExorcistRealistCowboy 48 58.16 100
View unlocking history of this single game only
The Mighty Quest For Epic Loot 36 -1 0 0.00 0 0.6114025712Strive for FiveGoing ProPunch Above your WeightPlease Mom, Can I Keep Him?The ButcherDecade of DestructionFashion Victim 36 44.32 100
View unlocking history of this single game only
Miner Wars 2081 12 -1 0 0.00 0 0.8502239585Completed mission EAC Survey SiteCompleted mission Barth’s moonCompleted mission Duncan’s Faith (Junkyard)Completed mission Junkyard (Racing)Completed mission Fort Valiant III. (Dungeons of Valiant)Completed mission The RiftShip Stanislav 12 24.01 100
View unlocking history of this single game only
Minimum 7 0.5590020418Sam the Slayer 1 0.56 14.3 0.7033451796Block BreakerHarvest MoonNot So Clever, GirlTurrets SyndromeThe Base of Broken ToysTitans Fall 6 7.99 85.7
View unlocking history of this single game only
Monaco 13 -1 0 0.00 0 0.5846533179MassacreDem BonesWhackedTechnicianSlipperySilent WithdrawalI Work Alone 13 20.83 100
View unlocking history of this single game only
Mountain 31 -1 0 0.00 0 0.6439278722I'm A Musician?Hello ThereI'm ThinkingI Can Sing!Who's Doing This?Am I Interesting?Is This Normal? 31 34.53 100
View unlocking history of this single game only
Muffin Knight 55 0.8832440376Death from Above 1 0.88 1.8 1.2376078367Serial KillerKitchen HelperQuad PreyWeekend HunterAirstrikeThe Big HuntFlawless Victory 54 94.12 98.2
View unlocking history of this single game only
Multiwinia 12 -1 0 0.00 16.7 1.3653839827CarnageDominatorHail to the KingBlitzMasterMaster PlayerHoarderUnclad Skies 12-2 27.91 100
View unlocking history of this single game only
Mutant Storm Reloaded 12 -1 0 0.00 0 0.97030735022x Multiplier4x MultiplierYellow BeltOrange BeltGreen BeltPurple BeltBlue Belt 12 26.81 100
View unlocking history of this single game only
NARUTO SHIPPUDEN: Ultimate Ninja STORM 3 Full Burst 54 -1 0 0.00 0 0.2971865535Burning Hidden Leaf VillageA Hidden MemoryGem of a CardTake This!!!Battle of Hidden LeafCreeping ShadowCrash the Five Kage Summit 54 39.90 100
View unlocking history of this single game only
Nation Red 145 -1 0 0.00 0 0.2881689072HordeSpeedKillerGunbarrelArms DealerLadies FirstFortressEfficiency 145 176.13 100
View unlocking history of this single game only
Natural Selection 2 137 -1 0 0.00 0 1.1211599112They Just Keep ComingTSFFirst AdventureStrategic ThinkingKharaaDemolitionsFirst Class Post 137 398.08 100
View unlocking history of this single game only
Neon Drive 16 -1 0 0.00 0 0.8059651256BraveheartWinnerAddictionDestroyerPerseveranceClassic ExplorerHardship 16 22.07 100
View unlocking history of this single game only
Never Alone (Kisima Ingitchuna) 15 -1 0 0.00 0 0.4470059872Close CallTundra ExpertHomecomingBola ExpertVillage HistorianSwallowedSea and Air 15 10.56 100
View unlocking history of this single game only
NiGHTS into Dreams... 13 -1 0 0.00 0 1.3469574451the IDEALthe AFFECTIONHello Mepianthe POSSIBILITYthe CONSCIOUSNESSthe CONFUSIONthe REVIVAL 13 22.07 100
View unlocking history of this single game only
NightSky 22 -1 0 0.00 0 1.3162169456PrologueHarara MountainsSkymningOld RuinsPerpetuum FactoryRanna CavernsPrologue Alternative 22 37.92 100
View unlocking history of this single game only
Nuclear Dawn 58 0.9367784858Trained: Soldier GraduateTrained: Commander GraduateLife, InterruptedSpread The PainI Don't Like Bunnies 5 3.90 8.6 0.6794484854The Smell of Victory In The MorningBloodlustThat's The Way You Hold ThemI'm Just Shy...I MoisturizeBig Game HunterSneak Kill 53 85.06 91.4
View unlocking history of this single game only
Octodad: Dadliest Catch 32 -1 0 0.00 0 0.4474301338Be the ControllerAu NaturelNo CutsiesWorld's Best DadThe Hero they DeserveStairs with AttitudeDancing in the Dark 32 39.66 100
View unlocking history of this single game only
Offspring Fling! 10 0.4683929086Starting an Adventure! 1 0.47 10 1.3585865498Dinobaus DefeatedFlower ChampionGolden ChampionRainbow ChampionCrown of MotherhoodFull ParryAll Clear 9 18.50 90
View unlocking history of this single game only
Offworld Trading Company 194 -1 0 0.00 0 0.5451190472Business Building SeminarCorporations Are PeopleMake It WorkBetter Living Through ChemistryThe Power WithinSkirmish Win (Applicant)Campaign Started 194 423.98 100
View unlocking history of this single game only
Oil Rush 40 -1 0 0.00 0 0.7614492774Fresh meatExecutionerLaw and OrderParanoidWorkaholicMine! Mine! Mine!Seasoned Kamikaze 40 80.00 100
View unlocking history of this single game only
One Finger Death Punch 152 -1 0 0.00 0 0.220360726110 kill StreakSuper ComboSo it's Just Two Buttons?10 Objects SmashedMy First Gold Medal25 kill StreakThose Bad Guys are Called Brawlers 152 160.36 100
View unlocking history of this single game only
One Way Heroics 44 0.7892919183My First TreasureMy First Perk2 Legit 2 QuitFirst Time HuntMy First VaultInto DarknessLicense on life 7 4.39 15.9 0.6936046481A Real ProFind a new jerbMission AccomplishedWalk in the parkA Taste of DarknessForce SensitiveI Need More Power!!! 37 46.47 84.1
View unlocking history of this single game only
Orcs Must Die! 27 1.2187273502No Traps for You!Skin of your TeethTunnel VisionOgre BisqueMaster War MageDroppin' Ten LargeKeepmaster 14 9.90 51.9 0.9055610299What a Mess!Tenderized!Pow! Pow!Who Wants Pancakes?Who Wants Some?!In your Face!Great Balls of Fire! 13 16.62 48.1
View unlocking history of this single game only
Orcs Must Die! 2 27 -1 0 0.00 0 0.2193752229Ten at OnceDroppin' HamiltonsHalfway ThereBig SpenderQueen of the OrcsIndecisiveThanks Bro 27 26.54 100
View unlocking history of this single game only
Orcs Must Die! Unchained 132 -1 0 0.00 0 0.8560428023Second TierShoot Them DownWar Mage Warm-UpSabotage 101FreeloaderAir-BlackpawVictory Nap Earned 132 267.07 100
View unlocking history of this single game only
ORION: Prelude 251 0.8177031279Who Needs Teammates! 1 0.82 0.4 0.3539476097CavemanWelcome to PersistenceDino BomberBravo!Where's Waldo?Manly ManAlpha Male! 250 444.75 99.6
View unlocking history of this single game only
Orwell 27 -1 0 0.00 0 0.6682086587Torture myself with whimsiesThe Clocks were Striking ThirteenA Place where there is No DarknessUnpersonWith powder and leadMemory HoleOne can deny me 27 29.83 100
View unlocking history of this single game only
Osmos 11 0.8723757863VoyagerDisciple of the Osmos 2 1.23 18.2 0.9367634654FittestPurityBlack Hole SunGraduate of the OsmosGravitronicsMaster of the DeepViral Master 9 13.60 81.8
View unlocking history of this single game only
Out of the Park Baseball 17 63 -1 0 0.00 0 1.4486366510Batting AroundOn a RollBatter of the MonthPitcher of the MonthGoing to the PlayoffsRookie of the MonthHit Machine 63 128.62 100
View unlocking history of this single game only
Out of the Park Baseball 18 78 -1 0 0.00 0 1.3555935621On a RollBatting AroundBatter of the MonthPitcher of the MonthRookie of the MonthAchievement CompleteQuality Outing 78 149.32 100
View unlocking history of this single game only
Outland 12 -1 0 0.00 0 1.1732510328That’s TeamworkEnthusiastEnvironmental ExterminatorDon’t Go AloneGrand MasterTwo BirdsOverkill 12 20.04 100
View unlocking history of this single game only
Oxenfree 13 -1 0 0.00 0 0.6904548407It's A Me"This House is Clear"New BeginningsMatchmakerAdler Letters, Pt. 1You'd just end up hating each other.Renjamin Spanklin 13 14.35 100
View unlocking history of this single game only
PAC-MAN 256 10 -1 0 0.00 0 0.6743792295Dot MuncherGhost HunterWakka WakkaStaying HealthySuper 256Maximum PowerMission Complete 10 10.32 100
View unlocking history of this single game only
Paladins 58 0.3102935553Well TrainedCounter-Air Defense 2 0.56 3.4 0.1879724860UntouchedTeamed Up BronzeNot Like ThisChampion Mastery IDouble Kills BronzeI Like Big NumbersHard Carry 56 42.66 96.6
View unlocking history of this single game only
Papers, Please 13 0.7374551892Impor TokenToo HonestAntegria TokenObristan Token 4 2.24 30.8 0.5363366604Arstotzka TokenKolechia TokenHired RifleUnited Federation TokenRepublia TokenGlory to ArstotzkaMember of the Order 9 8.18 69.2
View unlocking history of this single game only
Papo & Yo 10 1.0415301323Playing TagConclusionGood as NewSharp SplatterCalm After the StormLula Power 6 5.25 60 1.0811063051White Frog MassacreThe ArchitectDon't Need No HintsMad Hatter 4 5.08 40
View unlocking history of this single game only
Path of Exile 127 0.9854183197Full Clear: CatacombsFull Clear: Ship Graveyard CaveParadigm ShiftTime CapsuleA New DawnCryomancerElemental Trinity 9 4.98 7.1 0.4395486116One of a KindRest for the WickedFreedomGeared UpPurifierChallengerBringer of Pain 118 138.03 92.9
View unlocking history of this single game only
PAYDAY 2 701 -1 0 0.00 0 0.1220927909No One Cared Who I Was...No Turning BackYou Gotta Start SomewhereHow Do You Like Me Now?Guilty of CrimeWould You Like Your Receipt?Armed to the Teeth 701 799.39 100
View unlocking history of this single game only
PAYDAY: The Heist 48 -1 0 0.00 0 0.2124101669I ain't afraid no moreEagle eyesCivil disobedienceDiplomaticCheney?Last ChristmasDodge this! 48 61.52 100
View unlocking history of this single game only
Perpetuum 34 -1 0 0.00 0 0.8231342435Hmm, upgradesI'm doing my part!Reporting for dutyI know kung fuSpark of changeWhac-A-DroneMaxed out 34 58.33 100
View unlocking history of this single game only
Pid 12 -1 0 0.00 0 0.5823917985The first memoryYoung CartographerBothersome guestJunior ExplorerLittle guestGoodbye little guestSenior Explorer 12 20.55 100
View unlocking history of this single game only
Pixel Piracy 31 1.2126855850Gotta catch em all..Robinson Hobo'dBounty!NoobYARRRRRRRRPOOPdeck...Grand Theft Marine 12 8.82 38.7 0.8936561346Lives up to his name!Socially inadequateI'm a mighty pirate!Kung Fu FightingWho be makin this game?Mutiny!Jolly Roger That 19 29.86 61.3
View unlocking history of this single game only
PixelJunk Eden 61 -1 0 0.00 0 0.4132474065Welcome to EdenThat Growing FeelingSpectral DiscoveryHi-FiverThe Green LifeBreakthroughJumper 61 105.79 100
View unlocking history of this single game only
Planetary Annihilation: TITANS 20 -1 0 0.00 0 0.8346512318EfficientFully OperationalOne DownTeam PlayerJack of All TradesTechnophileWorldbuilder 20 31.03 100
View unlocking history of this single game only
Plants vs. Zombies: Game of the Year 21 0.6795378923Beyond the GraveRoll Some HeadsHome Lawn SecurityDisco is UndeadPenny PincherExplodonatorSPUDOW! 7 2.58 33.3 0.6093804836Ask Me About Mustache ModeSunny DaysMorticulturalistDon't Pea in the PoolNo Fungus Among UsNobel Peas PrizeGrounded 14 10.79 66.7
View unlocking history of this single game only
Point Perfect 10 -1 0 0.00 0 1.3376541138Get trolled!Persistence.Make a wish!Combo King!Bullet proof!Slayer!Golden! 10 19.35 100
View unlocking history of this single game only
Poker Night 2 18 0.7765495181This Was a TriumphPersonality Goes a Long WayOrb 'n' LegendsBook 'EmBanjo HeroTrophy WifeBorder Crossing 13 5.83 72.2 0.5389578938Sam to the MaxJoint VentureArmy SurplusUnlock all the ThingsWe Are the 1% 5 3.76 27.8
View unlocking history of this single game only
Poker Night at the Inventory 20 0.6639567614Three Wise MenDown to the GreenSlow PlayRags to RichesSpecial Item: TychoSpecial Item: Strong BadSpecial Item: Max 16 6.17 80 0.3242127597FlushFour of a KindWin A Game, HardStraight Flush 4 3.25 20
View unlocking history of this single game only
Poly Bridge 22 -1 0 0.00 0 0.2889585197Tutorial CompletedCompleted Alpine MeadowsCompleted Alpine Meadows Under BudgetCompleted Alpine Meadows Under Budget and Under 100% StressCompleted Desert WindsCompleted Desert Winds Under BudgetCompleted Desert Winds Under Budget and Under 100% Stress 22 32.96 100
View unlocking history of this single game only
Portal 15 0.3187790215Friendly FireHeartbreakerPartygoerFratricideLab Rat 5 1.36 33.3 0.5993409753CupcakeLong JumpFruitcakeTerminal VelocityVanilla Crazy CakeTransmission ReceivedCamera Shy 10 9.43 66.7
View unlocking history of this single game only
Portal 2 51 0.8082842827Pit BossPreservation of MassDrop BoxScanned AloneNo Hard FeelingsThe Part Where He Kills YouLunacy 19 6.59 37.3 0.2238524258High FiveTeam BuildingConfidence BuildingAir ShowBridge BuildingGood ListenerGesticul-8 32 25.08 62.7
View unlocking history of this single game only
Primal Carnage 67 -1 0 0.00 0 0.2699688971Carnage BeginsSize MattersSquashed Like a Bug!Picky PickyPrimalCold-bloodedExtinct 67 84.13 100
View unlocking history of this single game only
Primal Fears 29 -1 0 0.00 0 0.7322112322Bonus 10NewsBonus 50Bonus 10010 Kills100 KillsHospital 29 41.90 100
View unlocking history of this single game only
Prison Architect 18 -1 0 0.00 0 0.6048703790Get Busy LivingStone WallsWardenWait and HopeSpare The RodSamuel NortonI May Have Found A Way Out Of Here 18 22.69 100
View unlocking history of this single game only
Project CARS 45 -1 0 0.00 0 0.5804530382Ready To PounceTwerkin'On Your LeftKeep Calm And Race OnPit BossConquered. All. Races. Seriously.Do You Smell Somethin'? 45 70.62 100
View unlocking history of this single game only
Psychonauts 37 -1 0 0.00 0 0.6254410148Your Last Chance to Chicken OutA Victory for Good TasteJunior PSI CadetRolling Rock StarFor Insurance ReasonsRegular PSI CadetTime to Deliver the Milk 37 44.95 100
View unlocking history of this single game only
Puzzle Agent 2 52 -1 0 0.00 0 0.8172672391Christmas Tree CensusPuzzle: Moon FocusPuzzle: Monosaki Puzzle #320Welcome Back!Puzzle: Finding VacancyValda's InnPuzzle: Hidden Sightings 52 51.29 100
View unlocking history of this single game only
Q.U.B.E. 20 -1 0 0.00 0 0.6386110187Quick Understanding Of Block ExtrusionSector 1, CompletedSector 2, CompletedSector 3, CompletedSector 4, CompletedAttractiveSector 5, Completed 20 22.86 100
View unlocking history of this single game only
Q.U.B.E: Director's Cut 53 -1 0 0.00 0 0.7438403368Quick Understanding Of Block ExtrusionSector 1, CompletedSector 2, CompletedSector 3, CompletedSector 4, CompletedAttractiveSector 5, Completed 53 88.80 100
View unlocking history of this single game only
Quantum Break 42 -1 0 0.00 0 0.3783955574A Fracture in TimeMysterious StrangerHold on to Your Hope and BurnMarketing SpielChronon SurgeA Link To The FutureEverybody Gather Around 42 30.33 100
View unlocking history of this single game only
Quantum Conundrum 15 0.5127141476Dimensional DrifterTesting the FencesWell, look what you found thereNuclear Nooby 4 1.66 26.7 0.7651726604Symmetrical SojournerPeerless PerambulatorBig MeanieExtraordinaire ExtrapolatorArt MajorDid a Thing!Ah, finally some peace and quiet 11 14.32 73.3
View unlocking history of this single game only
Race The Sun 25 -1 0 0.00 0 0.3638252914SparrowBishopMagellanLindberghSwallowRookArmstrong 25 35.54 100
View unlocking history of this single game only
Razor2: Hidden Skies 10 -1 0 0.00 0 0.9558337927Clean UpHot FireSafe FlyBig ShotZero RemainNo MercyWar Hero 10 15.79 100
View unlocking history of this single game only
Really Big Sky 20 1.0432635546500 KILLSWAS RISKYMR BLOBBY 3 2.98 15 1.1675593853CLOSE ENCOUNTERSMULTI X50LEVEL 5BOSS KILLACONSERVASAURUSKILLED BIGGUNSMAX POWERUPS 17 30.53 85
View unlocking history of this single game only
Realm of the Mad God Exalt 31 1.0443778038The PolymathNo More GatheringOf Shining ArmorThe Highest LevelCarry a Big StickQuiveringWalk Softly 10 6.09 32.3 0.9317647815Black MagicOn Your MarkEnchantingBe EnigmaticGet TrickyBlue StarEnemy of the Gods 21 31.97 67.7
View unlocking history of this single game only
Rebel Galaxy 37 -1 0 0.00 0 0.7511904836A New FriendSweet New RideSome MuscleBounty HunterOn The GoSure ShotJumper 37 46.40 100
View unlocking history of this single game only
Rebuild 3: Gangs of Deadsville 42 1.0546238422El PacifistoThe Precious JuiceHumankillerBFFsAssembly LineDead AgainSnoqualmie 11 9.21 26.2 1.0977572203Cow ClickerNeed More HandsDeath MachineFully CompletelyRocket ScientistHeroes Never DieThe Eradicator 31 47.29 73.8
View unlocking history of this single game only
Red Faction: Armageddon 48 -1 0 0.00 0 0.5841472149Unto The BreachSecrets Long BuriedWe're Not AloneMartian MatchmakerVanguardCrack ShotThings Fall Apart 48 59.49 100
View unlocking history of this single game only
Red Faction: Guerrilla Steam Edition 60 -1 0 0.00 0 0.6503645182WELCOMING COMMITTEEMARTIAN TEA PARTYSPREAD THE WORDINSURGENTONE MAN ARMYDEATH FROM ABOVETANK BUSTER 60 108.02 100
View unlocking history of this single game only
Red Orchestra 2: Heroes of Stalingrad - Single Player 29 -1 0 0.00 0 0.8255952001Boot CampGerman Campaign 1Leadership CampGerman Campaign 2StonewallGerman Campaign 3Support Camp 29 46.21 100
View unlocking history of this single game only
Red Orchestra: Ostfront 41-45 44 -1 0 0.00 0 0.9200477600Kills - BronzeKills - SilverKills - GoldExcellent Marksman – BronzeCountersniperJohnny on the Spot - BronzeOff the Tracks - Bronze 44 87.32 100
View unlocking history of this single game only
Regency Solitaire 17 -1 0 0.00 0 0.5871825218Combo DebutanteDouble Your MoneyStarstruckA Woman of MeansVisit LondonA Vertitable FortunePerfectionist 17 14.14 100
View unlocking history of this single game only
Renegade Ops 12 -1 0 0.00 0 0.8524090648AirborneA Mess of Stiff Staff SergeantsFrom Cold Dead HandsJonesing for RelicsSupply ProblemsTo Hell and BackInferno's Briefs 12 18.19 100
View unlocking history of this single game only
Retro City Rampage™ DX 20 -1 0 0.00 0 0.3057352006You Broke The Law!Killabunga!8-BlowPixel Me Rollin'Feeling GroggyBike BounceEco-friendly Fire 20 25.36 100
View unlocking history of this single game only
Reus 123 -1 0 0.00 0 0.2241771817The First EraFarmingA New BeginningPaganismWritingA New ThreatSwamp Tribe 123 178.14 100
View unlocking history of this single game only
Revenge of the Titans 77 1.8233197927SIZZLE SIZZLEMARS COMPLETEDEFENDERTHRIFTYNEGLIGENTVANQUISHED 2500PHEW! THAT WAS CLOSE 30 25.69 39 0.7489756942DRUNKEN FAMILY ARGUMENTSHORT ARMS DEEP POCKETSDISAPPOINTING PRESENTSDEATH FROM THE SKIESUNDERCOOKED TURKEYNO-ONE LIKES XMAS PUDDINGSPROUT FLATULENCE 47 78.22 61
View unlocking history of this single game only
Ring Runner: Flight of the Sages 175 -1 0 0.00 0 1.1681584120Peanut Butter SageScenarios UnlockedHangar UnlockedMultiplayer UnlockedShop UnlockedStarter PackHull Collector: 25% 175 430.35 100
View unlocking history of this single game only
Rise of Nations: Extended Edition 38 1.4921121597Student Of WarAssassinKnockoutWonderGeniusEconomical GuruBig Huge 9 8.01 23.7 0.6259502172GenerousArchaeologistTerritoryColonelArmageddonBrigadierMarco Polo 29 43.27 76.3
View unlocking history of this single game only
Rise of the Tomb Raider 66 -1 0 0.00 0 0.1886452436Following in Father's FootstepsTougher Than She LooksQuite A TumbleReading the PastOne-Sided ConversationChallengingStrange Acquaintance 66 53.31 100
View unlocking history of this single game only
Rising Storm/Red Orchestra 2 Multiplayer 140 -1 0 0.00 16.4 0.5179954171Territory RookieKills BronzeMarksman BronzeBoot CampTo The Front!Sharpshooter BronzeExperienced Territory 140-23 259.20 100
View unlocking history of this single game only
RIVE 44 -1 0 0.00 0 0.8214123249Breaking and EnteringCaptain AhabSleeping with the FishesEye of the Tiger01110100 01101000 01100101 00000001Master of the UniversePay Attention, Houdini! 44 98.54 100
View unlocking history of this single game only
Robocraft 43 -1 0 0.00 0 0.9632725120Bronze RankHurt LockerProtonium MinerPower ShopperPoints of LightI Got ThisSilver Rank 43 74.29 100
View unlocking history of this single game only
Rochard 14 -1 0 0.00 0 0.5848550200BowlingUnfriendly FireElectrifriedSecond AmendmentDeath from Above25% Gold Collectibles FoundKiss Me Deadly 14 15.45 100
View unlocking history of this single game only
Rock of Ages 19 1.2273960114Flawless VictoryBreakerEscape from Hades 3 1.80 15.8 0.5671838522BerserkerSmasherSnowball WarEagle EyeObliterator - New boulder unlocked!Top ShotTrollFace Unlocked! 16 17.49 84.2
View unlocking history of this single game only
Rogue Legacy 29 -1 0 0.00 0 0.1382225454AtelophobiaBiophobiaRhabdophiliaAlektorophobiaGymnophobiaAurophiliaOmmetaphobia 29 20.99 100
View unlocking history of this single game only
Rust 75 -1 0 0.00 0 0.2699645460Visit a RoadCollect 300 Metal OreDestroy 10 BarrelsConstruct BaseCollect 65 ScrapAcquire 50 Low Grade FuelUpgrade Base 75 87.69 100
View unlocking history of this single game only
SanctuaryRPG: Black Edition 6 -1 0 0.00 100 50[Not Implemented Yet] Empty Nest Syndrome[Not Implemented Yet] Great Uncle Midas[Not Implemented Yet] Nooks and Grannies[Not Implemented Yet] Steel-Toed Potato[Not Implemented Yet] Indisputable Champion[Not Implemented Yet] Mark of Infinite Dedication 6-6 0.00 100
View unlocking history of this single game only
Sanctum 79 0.9317452312MartyrBombing Raid 2 1.43 2.5 0.4613090754It's Cool, I've got this599 US DollarsShift's OverIf you Replace the Working Parts...Giant Enemy CrabYou shall not PASS!Et Tu Brute 77 114.14 97.5
View unlocking history of this single game only
Sanctum 2 43 -1 0 0.00 0 0.3967722952Humble BeginningsMr. PerfectCome at me bro!The Best Defense is OffenseThe Bas(e)icsGibbs, gibbs everywhereCoffee Stained 43 64.66 100
View unlocking history of this single game only
Savage Lands 20 -1 0 0.00 0 0.6082450151First BloodFIRE!Clobbering TimeThe BasicsProspectorBrittle BonesEntering the Unknown 20 22.69 100
View unlocking history of this single game only
Scribblenauts Unlimited 25 0.5112751722Maxwell in DisguiseRex the Dinosaur HunterTry This InsteadPatches and his KiteHelping HandMake it YoursMagical Globe for Rent 7 2.97 28 0.5372219086Yarrr, matey!Chillin’ with ChillyTony and the OutlawWindow ShoppingBubbles’ Magical Aquatic AdventureBuzzing to the StarsSister Savior 18 18.05 72
View unlocking history of this single game only
Seasons after Fall 21 -1 0 0.00 0 0.6750565171An awakeningWinter frescoFall frescoSpring frescoSummer frescoA signA nightmare 21 23.89 100
View unlocking history of this single game only
Secret of the Magic Crystal 13 -1 0 0.00 0 0.9794055223GratitudeContest Winner I.GratitudeContest Winner II.GratitudeContest Winner III.Gratitude 13 20.46 100
View unlocking history of this single game only
SEGA Bass Fishing 12 -1 0 0.00 0 1.3218885660A Gift LureArcade WinnerUnbelievable SizeAmateur WinnerRanker KillerProfessional WinnerChallenge Winner 12 26.49 100
View unlocking history of this single game only
SEGA Mega Drive & Genesis Classics 25 -1 0 0.00 0 1.4848986864500 Rings to Rule them AllWhat are the Buttons?Challenge AcceptedExtra HedgehogsFive LargeCommitmentExperiencing History 25 54.31 100
View unlocking history of this single game only
Sentinels of the Multiverse 73 -1 0 0.00 0 0.9592535496Battle TestedHAKA CRUSHMedic!The Super Scientific TachyonProtector of WorldsThe Hero We NeedG.I. Bunker 73 170.38 100
View unlocking history of this single game only
Serious Sam 3: BFE 61 -1 0 0.00 0 0.3155634105Wanted Dead or AliveBug HuntSerious BeginnerChain ExplosionArachnophobiaGet the hell off my ride!Ophthalmologist 61 65.35 100
View unlocking history of this single game only
Serious Sam Classics: Revolution 42 -1 0 0.00 0 0.9201326966Forth to the pastThere can be only one!With our powers combinedThe talk of partiesA message to the starsNo Fridge to HideGoing with the Wind 42 78.03 100
View unlocking history of this single game only
Serious Sam Double D XXL 30 -1 0 0.00 0 0.8171612620Unflinching SamWhite Men Can JumpGnaar-body's FoolFully StackedTime to Eat the DoughnutsTreasure SeekerSkeletons in the Closet 30 44.59 100
View unlocking history of this single game only
Serious Sam HD: The First Encounter 35 -1 0 0.00 0 0.3748185039Serious BeginnerSwimming InstructorCo-op BeginnerGame MasterCannon ExpertLook Ma, I won!Rocket Jumper 35 57.65 100
View unlocking history of this single game only
Serious Sam HD: The Second Encounter 70 -1 0 0.00 0 0.6637502313Treasure DivingSerious BeginnerCo-op BeginnerSouth America MasterBurn Baby, BurnMedieval MasterPersia Master 70 118.55 100
View unlocking history of this single game only
Shantae and the Pirate's Curse 44 -1 0 0.00 0 0.5692217350Ret-2-go!Smells like victory!Special WeaponryGreen ThumbEww! Eew! Eew!ArachnophobiaPest Control 44 52.45 100
View unlocking history of this single game only
Shantae: Risky's Revenge - Director's Cut 26 -1 0 0.00 0 0.4303594232Ret-2-Go!You Are Here!Yakkety Yak!Elephant Obliteration!Speed Run the Baron's Lair!Enough For Everyone!Bonfire! 26 31.71 100
View unlocking history of this single game only
Shatter 30 -1 0 0.00 0 0.2720921934ShardenfreudeKinetic HarvestStorm WarningBalls GaloreAuroraGranule ExtractorKrypton Garden 30 41.73 100
View unlocking history of this single game only
Shelter 2 20 -1 0 0.00 0 1.2433876991Circle of LifeA New StartThree GenerationsBlue FeatherMaternal InstinctFox SkullFive Generations 20 41.76 100
View unlocking history of this single game only
The Shrouded Isle 16 -1 0 0.00 0 1.5116493702Inquisitor's PetThe Matron's AllySupervisor of the AdjudicatorAwakenedThe Vicar's ConfessorSugar DaddySunken Sins 16 29.45 100
View unlocking history of this single game only
Sid Meier's Ace Patrol 52 -1 0 0.00 0 0.9472187161British Ace Pilot (5 Victories)ZeppelinWin an Offensive - BritishHat Trick - RookieWin a Mission - PilotDestroy an enemy supply train5,000 point mission - British 52 96.02 100
View unlocking history of this single game only
Sid Meier's Ace Patrol: Pacific Skies 50 -1 0 0.00 0 1.3627544641Hat Trick - RookieUS Navy Ace Pilot (5 Victories)US Army Ace Pilot (5 Victories)Win a Battle - US NavyWin a Battle - US ArmyWin a Mission - PilotFour Aces 50 102.47 100
View unlocking history of this single game only
Sid Meier's Civilization V 118 1.2418861389First of the MohicansPeople of the LonghouseOne to Rule Them AllAmongst the Catacombs of Nephren-KaVeni, Vidi, ViciTomb RaiderWith an Iron Fist 44 23.84 37.3 0.3224414289Neighborhood BullyDeath Before ShameEighty-Eight Miles per HourExpansionistExterminate! Exterminate!Team PlayerExperimenter 74 88.97 62.7
View unlocking history of this single game only
Civilization V - Civ and Scenario Pack: Polynesia 10 0.1788806170Law of the Splintered Paddle 1 0.18 10 0.2453503013Do you have a little Captain in you?This isn't KansasSearching for the PreciousBook 'em Danno!Heads Up!Bora! Bora! Bora!Surviving the Marquesas 9 4.09 90
View unlocking history of this single game only
Sid Meier's Civilization V: Brave New World 60 -1 0 0.00 0 0.3928353488Highway RobberyArtistic LicenseSoma Tablets for EveryoneMerchant PrinceLingua FrancaLegends of the Hidden TempleRocking in the Free World 60 75.69 100
View unlocking history of this single game only
Sid Meier's Civilization V: Gods and Kings 51 0.7714518309Intelligence NetworkIndoctrinated!Sticky FingersWhack a MoleMissionary ManPropheteeringGad Zeus! 7 1.84 13.7 0.1814365089Smooth TalkingHolier Than ThouAccess DeniedJunta for Red OctoberWe are FamilyHoly FatherScourge of Everyone 44 59.09 86.3
View unlocking history of this single game only
Sid Meier's Civilization VI 134 -1 0 0.00 0 0.1770214736If You Build It, They Will ComeA Revolution Without DancingNew Orleans Style Spanish RiceEscort ServiceEverything is Awesome!!!Voyage of the MayflowerInvestment Banking 134 192.60 100
View unlocking history of this single game only
Sid Meier's Civilization: Beyond Earth 64 0.8997855186So Say We AllThe Sound Of InevitabilityOnce Upon A Time In SpaceMighty Fine ShindigA Fistful of DollarsWhat Was Once Only ImaginedEnergize 14 7.44 21.9 0.4876405001Patent PendingGodspeedA Planet the Very Brother of Your OwnLogic is the beginning of wisdomI've made a lot of special modifications myselfIt's Full of StarsHomo Aliena 50 57.12 78.1
View unlocking history of this single game only
Sid Meier's Civilization: Beyond Earth - Rising Tide 26 1.1011985540The VoyageurNeptune's GloryBest of Both WorldsSilent ServiceThe Stuff of LegendThe PrinceYou Have Chosen Wisely 13 7.64 50 0.7694531083Ahimsa'X' Never Marks the SpotThe Frontier is EverywhereWinter is ComingShai-HuludThy Sea So GreatSalam 13 14.56 50
View unlocking history of this single game only
SimplePlanes 72 -1 0 0.00 0 0.8208227158Test PilotPilot's LicenseHair On FireThey Got UsShort TakeoffAceCarrier Landing 72 153.31 100
View unlocking history of this single game only
Skyward Collapse 80 1.4095951319LabyrinthNemean Lion 2 2.73 2.5 1.2648761272SingasteinnCornucopiaAdamantinePalladiumHlidskjalfEldhrimnirFenrir 78 160.90 97.5
View unlocking history of this single game only
Slam Bolt Scrappers 27 -1 0 0.00 0 0.9675727487GraduateKing of the MountainDowntown DefenderBullseyeCity SaviorLuckyBrawler 27 57.40 100
View unlocking history of this single game only
Sleeping Dogs™ 50 -1 0 0.00 0 0.1785445809EnvironmentalistIn With the GangStrike GoldMinor FaceMan Around TownSlight SilverRookie 50 33.90 100
View unlocking history of this single game only
SMITE 319 0.6486741304After EffectLimit ThemFreeze!Minion MayhemLast HitPerfectLine Them Up 7 3.47 2.2 0.5166251063Double Edged SwordThat's Far Enough!Up You Go!Super CheerHelping HandPrecise ShotUse your Fists 312 448.44 97.8
View unlocking history of this single game only
Snapshot 36 0.5189288259Where am I? 1 0.52 2.8 0.5348992348Just the BeginningBling BlingGotta Catch 'em AllUp and UpNeed For SpeedSky's the LimitUnlock Chapter 2 35 64.91 97.2
View unlocking history of this single game only
Solar 2 25 0.9632660747SupremacyBig Crunch 2 1.43 8 0.7341784835Asteroid NurserySnowflake StarEliteBetrayalGet LostFlying BlindSuper Clock 23 34.94 92
View unlocking history of this single game only
Sonic & All-Stars Racing Transformed Collection 50 -1 0 0.00 0 0.2134744525Racing TransformedMagic SecondYou Got The Horn!Parts ShopMeteor StrikeCrack DownCatcher Pitcher 50 47.82 100
View unlocking history of this single game only
Sonic Adventure DX 15 -1 0 0.00 0 0.6867174506Miles "Tails" ProwerKnuckles the EchidnaAmy RoseE-102 "γ"Sonic the HedgehogBig the CatSuper Sonic 15 21.25 100
View unlocking history of this single game only
Space Channel 5: Part 2 12 -1 0 0.00 0 1.2190216780Hello WorldHOOOOO!!!!Passionate ReporterCompetent ReporterApprentice DancerAwesome DancerExcellent Reporter 12 25.44 100
View unlocking history of this single game only
Space Engineers 29 -1 0 0.00 0 0.5575012565Number 5 Is AliveLost In SpaceThe Harder They FallLock And LoadThe Bigger They AreWin-WinThe Story Begins 29 48.54 100
View unlocking history of this single game only
Space Hulk Ascension 163 -1 0 0.00 0 0.9654883742Honourable selfBolter ConfidentRain of BulletsTeam ExpertSlayer of MonstersKeep your DistancePyroclast 163 336.21 100
View unlocking history of this single game only
Space Pirates and Zombies 48 1.1599942446Rez LordBig Bada BoomOh the humanity!ExplorerMr. SciencePalm GreaserBigger is Better 28 22.30 58.3 0.7926729918NinjaSanta's Little HelperFrankenstein5th HorsemanMission MasterPower OverwhelmingUber Technician 20 29.03 41.7
View unlocking history of this single game only
Space Run Galaxy 30 -1 0 0.00 0 0.8454404473Budding Space RunnerElbow greaseThis is my ship!Experienced Space RunnerSshhh, it's a secret…Bigger is better!A real bargain! 30 54.06 100
View unlocking history of this single game only
SpaceChem 19 1.6276838779Materials Engineer of the PeopleIndustrial PhysicistEnvironmental EngineerJunior Permutation TechnicianPolar Expedition 5 6.39 26.3 0.9104765654Moustache Research AssistantMoustache ScientistDirector of Moustache ResearchScience is an Indoor ActivityJunior Performance SpecialistEfficiency SpecialistPerformance Specialist 14 20.14 73.7
View unlocking history of this single game only
Spec Ops: The Line 50 -1 0 0.00 0 0.3435568213They LiveSpotterTreacherous GroundThe Lost BattalionDesert StormArmy of OneThe Horror 50 36.27 100
View unlocking history of this single game only
Spiral Knights 54 0.9945046902Son of a Nutcracker!Applied EntropyHelping HandWorld of MoorcraftJump StartMission AccomplishedSwordsman 9 5.39 16.7 0.4164900184ArmorerGunslingerExpert SwordsmanHatterOne-Star SmithPharma SuitableExpert Gunslinger 45 50.10 83.3
View unlocking history of this single game only
Splice 16 0.8428736329Sequence 4 CompleteSequence 3 CompleteSequence 2 CompleteSequence 1 CompleteAngelicBaby Steps 6 3.67 37.5 0.9384902120Sequence 5 CompleteSequence 6 CompleteSequence 7 CompleteTranscendanceEpilogue Sequence 1 CompleteEpilogue Sequence 2 CompleteEpilogue Sequence 3 Complete 10 11.43 62.5
View unlocking history of this single game only
The Stanley Parable 10 -1 0 0.00 0 0.1846575290Beat the gameWelcome back!You can't jumpAchievementClick on door 430 five times.8888888888888888Go outside 10 5.18 100
View unlocking history of this single game only
STAR WARS™ Knights of the Old Republic™ II: The Sith Lords™ 57 -1 0 0.00 0 0.6682960987Larger WorldTraining WheelsStarting Down the Dark PathDancing QueenI Didn't Do It!In It For the MoneyAn Elegant Weapon 57 76.94 100
View unlocking history of this single game only
Starbound 51 1.2748982906Cramped ColonyFrom the AshesBug TrackerToo Heavy to KickKing BarbarianThe ResilientHome Sweet Home 26 15.88 51 0.7077327967Monster WhispererPerfectly Generic AchievementThe LoyalSweet RevengeStarbound ValleyThe ProtectorFeathered Friend 25 33.96 49
View unlocking history of this single game only
Starvoid 60 -1 0 0.00 0 1.0043220520You Are Not SpecialDing!Power OverwhelmingHasta La Vista, BabyGotta Catch ‘Em AllMaim! Kill! Burn!Epic Winning 60 184.37 100
View unlocking history of this single game only
Stealth Inc 2 12 -1 0 0.00 0 0.9676237702Scarlett PimperhellSuicide PactConnoisseur ClubBoast ProtocolFreedom FighterSnappy ThreadsUndead Army 12 23.82 100
View unlocking history of this single game only
Steam Marines 15 -1 0 0.00 0 1.2171391249Command DeathNo TicketHot ShotSargeWhere's SargeMedical DeathEngineering Death 15 36.49 100
View unlocking history of this single game only
SteamWorld Dig 24 0.3296123445Scratching the Surface 1 0.33 4.2 0.4430422783The GoodTrash ManMythical CreaturesIt Goes Deeper!?Support Your CommunityAssimilatedRock Bottom 23 23.82 95.8
View unlocking history of this single game only
SteamWorld Heist 42 -1 0 0.00 0 0.4486016631Tutorial GrindHat-off, Hat-onWell HattedBullet BouncerDrop the ChopTop of the HeapDown with the Queen 42 62.73 100
View unlocking history of this single game only
Strider 30 -1 0 0.00 0 0.7003457546Master of UnlockingRed Dragon AwaitsA Cold Wind BlowsAnother Soulless CopyI Got You!I'm Rubber, You're GlueRun Crying Back To Your Masters 30 39.00 100
View unlocking history of this single game only
Strife 46 -1 0 0.00 0 0.7425193191Step in to the ArenaTerror of the High SeasReady for BattleProphecy FulfilledCrux DestroyerThe Bounty Hunter of LyrieStrife Amateur 46 127.75 100
View unlocking history of this single game only
Strike Suit Zero 15 1.7433587313TORPEDO 1 CORVETTE ZEROTAKE ONE FOR THE TEAMSTRIKE SUIT COMBOTRANSFORMERACHILLES’ HEELTAILOR MADESTRIKE SUIT EVOLVED 8 7.30 53.3 1.1382367611STRIKE MODE EXTENDEDSHOOT THE MOONSAVE EARTHCOMPLETISTSAVE EARTH’S FUTURELUCKY STRIKESTRIKE FAST 7 11.88 46.7
View unlocking history of this single game only
Sunless Sea 53 1.4397751093Old Unhappy Far-Off ThingsSalt's CurseThe Fall of the HouseHE SUN THE SUN THE SUN TSound Mind?Thou, All-Shaking ThunderRules the Waves 11 10.05 20.8 0.9838503599CorrespondentShipmateLose your MindThe Ascent of ManOne Year at ZeeSalvagerPupil 42 70.31 79.2
View unlocking history of this single game only
Super Hexagon 6 -1 0 0.00 0 0.4819692075PointLineTriangleSquarePentagonHexagon 6 5.60 100
View unlocking history of this single game only
Super Monday Night Combat - Turbocross Bundle 4 0.2414557487All-Star AgentPro AgentVeteran AgentRookie Agent 4 0.53 100 100 0 0.00 0
View unlocking history of this single game only
Super Robot Jump Jump 31 -1 0 0.00 0 1.2927547693JumpYou DiedOffscreenSkeleton Boss100th Saw Death100th Spike DeathLost Your Hat 31 66.08 100
View unlocking history of this single game only
Super Sanctum TD 27 1.0396070480Skill MasterElectrifyingLook Mom I Did It!Environmental ExpertBring It OnMonsterkillTower Master 10 6.79 37 0.8392537832Core GuardianNow We're Talkin'I Hate MaizeGolden IdolAerial AceI Hold Everything!He Wasn't So Tough 17 20.79 63
View unlocking history of this single game only
Super Time Force Ultra 33 -1 0 0.00 0 0.6427869201That Was QuickTalent ScoutNumber One Shard198X Completed!3 Birds 1 StoneSpeed FreakBaby's First Glorb 33 43.37 100
View unlocking history of this single game only
Superbrothers: Sword & Sworcery EP 14 0.5663664937We Got the Megatome 1 0.57 7.1 0.8090080619The Ballad of the Space BabiesThe Mushroom KingdomThe Gold TrigonThe Dark Moon TrigonThe Bright Moon TrigonThe Grizzled BoorAssemble the Trigon Trifecta 13 15.43 92.9
View unlocking history of this single game only
Supreme Commander 2 47 -1 0 0.00 0 0.6352654099CakewalkCommunication BreakdownSecond TargetLudditeDeep FreezeInternet CommanderGood Game 47 56.08 100
View unlocking history of this single game only
Surgeon Simulator 72 1.5905541182Frikkin' LasersSurgetricityHow Long Can You Live Without A Brain?Archimedes!Don't Be Such A Baby, Ribs Grow Back!The Beat Of Your HeartGo For The Optics! 20 17.91 27.8 0.2787451148Flippin' The BirdPinky SwearShh I Doctor NowNine Nine Nine!Socialised Medicine!When You Have No Choice But To OperateWhat Could Possibly Go Wrong? 52 70.82 72.2
View unlocking history of this single game only
Survivor Squad 43 -1 0 0.00 0 0.8231830001Red SeaSilent but deadlyPerfect RunIt's been a whileOne of those threeTravellerOne by One 43 68.37 100
View unlocking history of this single game only
The Swapper 10 -1 0 0.00 0 0.9963709712IIIIIIIVVVIIX 10 11.19 100
View unlocking history of this single game only
Sword of the Stars: The Pit 147 0.6470522881Quintus NormalisRicky RecruitIncroyable!Touchdown! 4 1.76 2.7 0.5841407180TinkerQuintus FacilisI Feel So FunkyPsi RecruitDecimus FacilisBedazzledBlood and Pineapples 143 315.23 97.3
View unlocking history of this single game only
Swords and Soldiers HD 21 -1 0 0.00 0 0.8609630466Where are the Kangaroos?Vamos a la playa!Cooking by the BookAll I Want For Christmas Is YouV for VeggiesKeep Your Lousy ArmyI'm No Kung, Fool! 21 33.26 100
View unlocking history of this single game only
Syder Arcade 40 -1 0 0.00 0 0.6358705759Space Turtle ISpace Turtle IISpace Turtle IIIAction Hero IOmNomNom IDeath Dealer IOmNomNom II 40 52.11 100
View unlocking history of this single game only
Team Fortress 2 520 1.1676611900The Fight StuffPlan Nine to Outer SpaceBest Case ScenarioFive the Fast WayClassassinFailure to LaunchClaim Jumper 296 159.85 57.7 0.5012125969LumberjackOMGWTFBBQSawbonesScout Milestone 2Triple PlayFall ClassicDeep Undercover 224-4 203.37 42.3
View unlocking history of this single game only
Teleglitch: Die More Edition 39 -1 0 0.00 0 0.6827195883Novice SurvivorDid Not Become Eaten by PlanktonLiving Meat beats Dead MeatBomberman IThe Firm Index FingerSteroid MonsterDeath Pudding Matador 39 76.07 100
View unlocking history of this single game only
Terraria 115 0.8864402771Trout MonkeyGood Little SlaveGlorious Golden PoleReal Estate AgentMecha MayhemGelatin World TourBaleful Harvest 74 32.79 64.3 0.3948296010BenchedTemple RaiderDrax AttaxHey! Listen!Big BootyFish Out of WaterDye Hard 41 42.71 35.7
View unlocking history of this single game only
Terrorhedron 47 -1 0 0.00 0 0.7702074051Laser Turret - Level 14-Face Turret PlatformEMP Turret - Level 16-Face Turret PlatformPhoton Pulse Launcher Turret - Level 1Laser Turret - Level 2EMP Turret - Level 2 47 71.83 100
View unlocking history of this single game only
Tharsis 12 -1 0 0.00 0 0.9206456542Risk Management ProfessionalContact LightSafe PassageLocally GrownEthical ThresholdWork EthicI'm Going To Science The Snot Out Of This 12 19.12 100
View unlocking history of this single game only
Thinking with Time Machine 2 -1 0 0.00 100 50Impossible AchievementYou did it! 2-2 0.00 100
View unlocking history of this single game only
Thomas Was Alone 35 0.7308452725Distractions49 Shades of GreyDwindling CapacityThat's What You GetsAnd In the Darkness, Find ThemNeeds More HatsShared Hobby 30 16.76 85.7 0.5553027391A Token of LoveHuge SuccessThomas Was Not AloneThe Breakfast ClubThe Final MacGuffin 5 3.24 14.3
View unlocking history of this single game only
Ticket to Ride 25 -1 0 0.00 0 1.0184669495Pressure Gauge 803 Punched TicketsPressure Gauge 1206 Punched TicketsConductor Level 1Pressure Gauge 160Dynamite Joe 25 50.14 100
View unlocking history of this single game only
Ticket to Ride - USA 1910 5 -1 0 0.00 0 1.7505452633First TracksUrban TravellerModest EntrepreneurPressure Gauge 300Pressure Gauge 400 5 11.07 100
View unlocking history of this single game only
Tidalis 64 -1 0 0.00 0 0.7525990605Victory!Block Sweeper Mk IScore AficionadoDeep ThinkerPutting Things TogetherLosing is Fun!Welcoming Committee 64 90.60 100
View unlocking history of this single game only
Timberman 20 0.4037118256Double Tap 1 0.40 5 0.4763008356Angel of AxeLittle ElfFaithfulTriple TapMultitreeJust MagicScore Master 19 21.31 95
View unlocking history of this single game only
Tiny and Big: Grandpa's Leftovers 53 -1 0 0.00 0 0.5185874104OldschoolerStone CollectorMr FizzFabulous DentistMr BurstInvincible PupilGöttersturz. 53 72.94 100
View unlocking history of this single game only
TIS-100 10 -1 0 0.00 0 0.3962202966RTFMPARALLELIZEBUSY_LOOPHALT_AND_CATCH_FIRENO_BACKUPUNCONDITIONALILLEGAL_EAGLE 10 12.50 100
View unlocking history of this single game only
Titan Attacks 47 -1 0 0.00 0 0.4104515314SHARP SHOOTER10 SAUCERSQUICK DRAW MCGRAWWHOOPS!EARTHMARKSMANMULTIPLIER 47 46.33 100
View unlocking history of this single game only
Titan Souls 27 -1 0 0.00 0 0.6121864319First BloodOut of the Frying Pan......Into the FireTitan SoulLaser Eye SurgeryLeak SpinBeating the Yeti 27 42.98 100
View unlocking history of this single game only
To the Moon 1 -1 0 0.00 0 0.6059332490"Wish Granted" 1 0.61 100
View unlocking history of this single game only
Toki Tori 38 -1 0 0.00 0 0.3600642681So SadShort-order CookForest FallsHarderwijk Fried ChickenApprenticeDizzyClose Encounter 38 41.83 100
View unlocking history of this single game only
Toki Tori 2+ 38 -1 0 0.00 0 1.2882215977Left for batChirpaderpA pollo 13Frown jewelHeroic escapeSave Our SoulsSecond thoughts 38 68.19 100
View unlocking history of this single game only
Tomb Raider 50 0.9783785939The ProfessionalNo Stone Left UnturnedLethalBag Full O' CacheIntellectually SuperiorArchaeologistHistorian 25 14.95 50 0.5073637366Epic FumbleEqualizerWidowmakerBoom Goes the DynamiteFeather DusterSole SurvivorInconceivable! 25 31.58 50
View unlocking history of this single game only
Torchlight 66 0.4570968151Ka-Chunk!A Lich to ScratchBeast of BurdenFetch a Fair PriceOver the BrinkGibbedThe Adventure Begins 7 2.20 10.6 0.3670557737Shape-ShifterPet TrainerTree HuggerWhen this Town's a Rockin'WalkaboutWabam!Big and Green and Dead all Over 59 73.24 89.4
View unlocking history of this single game only
Torchlight II 119 -1 0 0.00 0 0.1364396811Treasure HunterGibsterSocketeerThe Felled GuardianBreakerFetch A Fair PriceWhen Grell Fell 119 96.41 100
View unlocking history of this single game only
Toribash 106 0.5246074200White Belt 1 0.52 0.9 0.7359045744Yellow BeltOrange BeltStudentGreen BeltAspiring FighterBlue BeltExperienced Kickboxer 105 250.92 99.1
View unlocking history of this single game only
Total War: EMPIRE - Definitive Edition 30 1.0679678917American HeroExpansionist PowerFounding Father 3 2.04 10 0.8012569547Raw RecruitA New RomeMaster of the AmericasWhiff of GrapeshotMaharajah of the IndiesBloodedPolymath 27 40.69 90
View unlocking history of this single game only
Total War: NAPOLEON - Definitive Edition 71 0.7301259041The Seal of the Grand CoalitionRevolutionary Cocarde 2 1.01 2.8 0.6119454503The Ribbon of the Promising StrategistThe Tireless Watchman BroochHistorians' College Acknowledgement BadgeHardened Veteran's BadgePalace Guard PendantBronze Star on Red RibbonThe Explorers' Society Badge 69 110.55 97.2
View unlocking history of this single game only
Total War: SHOGUN 2 106 -1 0 0.00 0 0.5127480626Unnecessary ForceCommander of CommonersHead-HunterForged in the Hottest FlameRedoubtableBalanced AttackerElusive Strike force 106 168.41 100
View unlocking history of this single game only
Total War: WARHAMMER 135 0.6752008200Up For A ScrapGoing UndergroundEmbark Upon Adventure! 3 1.48 2.2 0.3867679238Lucky StreakChampionPut Them to the TorchIron-Hard & AngrySeeker of PowerLeadership TestAppraiser 132 147.00 97.8
View unlocking history of this single game only
Tower of Guns 17 -1 0 0.00 0 0.9210650921Achievement Farming 101At Least You'll Get An Achievement For It...Why would you do such a thing?BlueGrass Is Still the BestStart With a Jump...And You Thought Magnetized Loot Was A Good Thing...I hope This Won't Break the Game 17 26.97 100
View unlocking history of this single game only
Train Simulator Classic 2024 84 -1 0 0.00 2.4 0.9429395199Train Simulator AcademyTrain Simulator AcademyTrain Simulator AcademyTrain Simulator AcademyClass 801: 801 EMU DriverTrain Simulator AcademyTrain Simulator Academy 84-2 151.79 100
View unlocking history of this single game only
Trainz Simulator 12 50 -1 0 0.00 0 0.8555089831Complete Tutorial 1Complete Tutorial 2Trainee HostlerComplete Tutorial 3CommuterComplete Tutorial 4Complete all Trainz Simulator Tutorials 50 121.70 100
View unlocking history of this single game only
Transistor 33 -1 0 0.00 0 0.2403944135Drive()Reisz()Bet()News()Spine()Align()Kendrell() 33 30.64 100
View unlocking history of this single game only
Trine 2 66 1.1211451292This Wasn't the PlanSecrets of Forlorn WildernessWild in WildernessInto the Story 4 2.29 6.1 0.4112285972I Didn't Do ItMudproof HeroMarch Through the MarshTreehouse AdventureNo More Lizard SoupA Floral FeastHammer Havoc 62 68.97 93.9
View unlocking history of this single game only
Trine 3: The Artifacts of Power 28 -1 0 0.00 0 0.5547830462Sheep HappensBut It Belongs in a Museum!I Like TurtlesStop Busting My WallsHoley Moley!A Friend of "Poetry"The King of the Jungle 28 24.03 100
View unlocking history of this single game only
Tropico 4 60 -1 0 0.00 0 0.6573663950The Full MontyFilthy RichNational AgendaInstant ConstructionHeavy TrafficForeign CuisineYou are Fired! 60 74.18 100
View unlocking history of this single game only
Tropico 5 50 -1 0 0.00 0 0.3397030234Heir And NowInfrastructorEverlasting ColonyA New DawnMine! All Mine!The Madness Of CrowdsA Barrel Of Monkeys 50 52.13 100
View unlocking history of this single game only
Tropico 5 - Espionage 10 -1 0 0.00 0 1.1786894798The Maltese ToucanTropicoleaksCatch me a SpyAntiutopiaFrom Tropico with loveBig BrotherKill all Humans 10 13.12 100
View unlocking history of this single game only
Turmoil 22 0.8029517531Cake!Good DealBig SpenderSerious MoneyBig SpillerShinyDubious Deal 11 6.28 50 0.8707764149Great DealStablelizedWorkshopperTip TopFactory ManThe Big HaulMillionaire 11 14.50 50
View unlocking history of this single game only
Two Worlds II HD 47 -1 0 0.00 0 1.3877233267The Great EscapeGrey WizardHammer Time!Into The FireAlchemistClairvoyantThe Antaloorian Job 47 97.84 100
View unlocking history of this single game only
Ultimate General: Gettysburg 3 -1 0 0.00 0 0.6050272584Battle of Gettysburg medalMedal of HonorSouthern Cross of Honor 3 3.52 100
View unlocking history of this single game only
Ultratron 67 -1 0 0.00 0 0.3802299500100 kills1000 shots fired100 dots250 dots500 kills500 dotsIeiunitas 67 80.61 100
View unlocking history of this single game only
Universe Sandbox Legacy 16 0.2651506960Snowball EarthOne MinuteStartup the Universe 3 0.49 18.8 0.3474481404One HourHeat WaveStartup DekaLearnerThe CodeThe AnswerPhotographer 13 13.92 81.3
View unlocking history of this single game only
Unmechanical 17 -1 0 0.00 0 0.6943762302We need to go deeperYou have tunneled into a new areaLike the Beat of a HeartMetal MeltdownEscapistTypicalPromotion 17 19.65 100
View unlocking history of this single game only
Unturned 77 -1 0 0.00 0 0.3172758520Behind the WheelWelcome to PEISchooledWelcome to WashingtonScavengerAccident ProneBerries 77 119.11 100
View unlocking history of this single game only
Valhalla Hills 26 -1 0 0.00 0 0.6949046850SummiteerBeginnerJunior-ArchitectArchitect in TrainingWooden Medal of FightingsAdvancedThe Big Name-Giver 26 49.62 100
View unlocking history of this single game only
Valkyria Chronicles™ 20 -1 0 0.00 0 0.6270745993The Crimson HeartThe Lance of GalliaGallian Medal of HonorFouzen Service MedalThe Bronze Arms of GalliaOrder of the Holy ShieldOrder of the Holy Lance 20 24.78 100
View unlocking history of this single game only
Vertex Dispenser 12 1.7412286997Mythic Portal 1 1.74 8.3 2.2872934341Polychromatic Apocalypse EngineColour ImplosionSecret WeaponDoppelpopolisSuper Portal RushEgg CartonIt's Only Fair 11 30.07 91.7
View unlocking history of this single game only
Vessel 20 -1 0 0.00 0 0.9330450892Water RecyclingFactory Line RepairDoctor of the Hydrofluric sciencesResearch Fellow of the Hydrofluric sciencesWindmill Repair ConsultantProtoplasm Survey: The FactoryMine Machinery Specialist 20 29.73 100
View unlocking history of this single game only
Victor Vran 50 -1 0 0.00 0 0.4533937573Tactical VranThe Five TrialsThe FallenDing!We are the Champions!Dances With SkeletonsTzar Bomba 50 57.65 100
View unlocking history of this single game only
Viking: Battle for Asgard 50 -1 0 0.00 0 1.1894648075Viking ButcherThirst For BloodDemon HackerChampion of ChampionsBlinded To FearLust For BloodAssassin of Assassins 50 84.07 100
View unlocking history of this single game only
Void Destroyer 24 -1 0 0.00 0 1.9503153563Cruisers Don't Run - 1First VictorySize Doesn't MatterNot Nearly EnoughBeachheadDogfight - TSFMega Annoying 24 70.47 100
View unlocking history of this single game only
Volume 24 -1 0 0.00 0 0.7009685636Rogue UnlikeImperial MarchWarming UpA Long WalkBe HeardThe First BalladLight Reading 24 34.58 100
View unlocking history of this single game only
VVVVVV 19 -1 0 0.00 0 1.0271958113Game CompleteSuper Gravitron: 5 SecondsLess than 500 deathsSuper Gravitron: 10 secondsLess than 250 deathsSuper Gravitron: 15 SecondsFlip Mode Complete 19 33.88 100
View unlocking history of this single game only
Waking Mars 17 -1 0 0.00 0 0.9035003185Research:  Halid ZoaResearch:  Hydron ZoaResearch:  CerebranesResearch:  Fertile TerrainResearch:  LarianResearch:  CycotResearch:  Feran Zoa 17 19.38 100
View unlocking history of this single game only
The Walking Dead 40 -1 0 0.00 0 0.2497481406Out of the Frying PanAdventures in BabysittingIn Your ChargeRock and a Hard PlaceIt's Just One BulletHey, BudTwo Enter, One Leaves 40 16.53 100
View unlocking history of this single game only
War of the Roses 21 -1 0 0.00 100 0.5985015035YeomanSquireCould be worseShire ReeveAlmost ThereGrand PlayerKnight 21-21 33.97 100
View unlocking history of this single game only
Warframe 193 0.8399220705Tenno and HoochSharp ShooterEgg TimerSaviour of VenusSentinel Proficiency IIRifle Proficiency IIIBlade Proficiency III 41 18.06 22.3 0.4989623129Bow Proficiency IEntrepreneurInventorPole Weapon Proficiency IShuriken Proficiency IPistol Proficiency IIIMerchant 152-2 145.29 77.7
View unlocking history of this single game only
Warhammer 40,000: Dawn of War II 73 1.6634727716Win the WarThe Enemy ExposedThe Avatar of KhaineThe Emperor's JusticeThe WarbossHold back the XenosHeavy Support 24 24.70 32.9 1.0245834589Tireless warriorAstronomicalThe Book of HonorDug InAllies to the CauseLightning AssassinThat's Close Enough 49 95.33 67.1
View unlocking history of this single game only
Warhammer 40,000: Dawn of War II - Chaos Rising 73 1.8667991161Bane of ChaosForbidden KnowledgeConqueror of ChaosEnemy of ChaosThe Challenge AnsweredRelentless 6 9.18 8.2 1.2013031244The Emperor's JusticeThe Enemy ExposedSweeping AdvancePurge the XenosWelcome to CalderisThere Is Only WarFeel No Pain 67 129.94 91.8
View unlocking history of this single game only
Warhammer 40,000: Dawn of War II - Retribution 75 -1 0 0.00 0 0.4933307469Superheavy SmackdownAll in a day's workPromethium SummerSummer SlayingSweeping AdvanceManipulatorTraitors 75 104.17 100
View unlocking history of this single game only
Warhammer 40,000: Dawn of War III 84 -1 0 0.00 0 0.5830715299The Defense Of Varlock Keep - Casual DifficultyThe Defense Of Varlock Keep - Normal DifficultyDestined For Greater Fings - Casual DifficultyDestined For Greater Fings - Normal DifficultyBeware False Profits - Casual DifficultyIn Defence of Loyalty - Casual DifficultyBeware False Profits - Normal Difficulty 84 133.06 100
View unlocking history of this single game only
Warhammer 40,000: Eternal Crusade 67 1.3619332314Maggon Station AttackPegasus DefenseTorias DefenseWarriorFort VictorySoldierScout 7 7.75 10.4 1.2286859751Maggon Station DefenseTorias AttackPegasus AttackBlackbolt AttackOlipsis AttackMedusa Relay DefenseBlackbolt Defense 60 112.47 89.6
View unlocking history of this single game only
Warhammer 40,000: Space Marine - Anniversary Edition 51 -1 0 0.00 0 0.4227264524The Might of the RighteousCommand SquadBlast RadiusInto the BreachDeath from AboveSilence the CannonPut Them Down 51 58.22 100
View unlocking history of this single game only
Warhammer: End Times - Vermintide 88 0.9748212695Temper FlareVon LiebensteinGauntletFirebrandDissidentSilver HammerEntrenchment 17 8.40 19.3 0.5329634547Accursed'Til Death Do Us PartState TrooperHoldseekerResistanceThe PiousForce Of Nature 71 111.48 80.7
View unlocking history of this single game only
Wasteland 2 46 -1 0 0.00 0 1.3033882380Know Your RootsWhat Does This Button Do?Locked And LoadedBetter Left BuriedWest Of EdenPeace On The RailsPop Idol 46 82.05 100
View unlocking history of this single game only
Wasteland 2: Director's Cut 46 -1 0 0.00 0 1.1094233990What Does This Button Do?Better Left BuriedLocked And LoadedPop IdolWasteland JusticeKnow Your RootsWest Of Eden 46 73.38 100
View unlocking history of this single game only
Waves 54 -1 0 0.00 0 0.6041663289Kill them all!Roundhouse KickCouldn't Hold It InGET TO THE CHOPPANeed a Breath MintThey just keep coming...Mega Kill 54 76.68 100
View unlocking history of this single game only
The Whispered World Special Edition 20 -1 0 0.00 0 0.9770351648Ball SpotFire SpotCanonball RideFor Whom the Bell TollsFive SpotKalida AwakesCheck Mate 20 27.34 100
View unlocking history of this single game only
WildStar 142 -1 0 0.00 0 0.4922120273Ground to BitsTriple ThreatSafety in NumbersA Heroes Journey Level 10Make a FriendSkeech ScorcherExpedition: They Came from Fragment Zero! 142 242.89 100
View unlocking history of this single game only
Windward 31 -1 0 0.00 0 0.4449832737CommissionedCuriosityNaval ProficiencyBucket o' PaintBargain BinThe Grinning SkullBigger is Better 31 30.78 100
View unlocking history of this single game only
Wizorb 20 -1 0 0.00 0 0.6445418596Silver BulletJelly BeansSlime MasherPerseusInfinite Loop?Cheat DeathTelekinesis 20 27.19 100
View unlocking history of this single game only
Woodle Tree Adventures 8 -1 0 0.00 0 0.8416729569Complete the first levelUnlock the yellow leafUnlock the orange leafBeat the gameUnlock the white leafPlay with a friend!Collect 1000 berries 8 8.53 100
View unlocking history of this single game only
Worms Crazy Golf 29 -1 0 0.00 0 0.6614675522Feel the PowerGentle StrokesFirst RoundYou Shoot You ScoreGetting The Hang of itTweet TweetWheres The Prey 29 33.88 100
View unlocking history of this single game only
Worms Reloaded 15 -1 0 0.00 0 0.516878783712 Days of WintervalHallelujah!Summer of '69Likes The DrinkSix PestProd For VictoryGet Your Lob On 15 20.14 100
View unlocking history of this single game only
Worms Revolution 29 1.1241270304KleptomaniacBug GulpAsinusFast LearnerWrecking BallSoldier KillerOne For The Money 9 5.93 31 1.0491812229TarzanThe Hard OneSquashed!Scientist KillerMy Gun, My KillScout KillerHeavy Killer 20 34.95 69
View unlocking history of this single game only
X3: Terran Conflict 33 -1 0 0.00 0 0.8471762538Crash CoursePirate FeverCombat ProCaptain of IndustryA Proud MomentLiberatorSolar Shock Wave 33 67.07 100
View unlocking history of this single game only
XCOM: Enemy Unknown 50 -1 0 0.00 0 0.1966414303We Happy FewWhat Wonders AwaitCombat ReadyAnd So It Begins…Eye in the SkyTables TurnedUp and Running 50 35.77 100
View unlocking history of this single game only
Zen Bound® 2 11 -1 0 0.00 0 0.5187884569Getting the Hang of ItGordianAnti SpikeUnwinderPacifistFlower GardenButterfly Collector 11 17.32 100
View unlocking history of this single game only
Zeno Clash 22 1.3891739845Door HaterZenozoik AdventurerTarget PracticeLight the Path 4 3.85 18.2 0.6371570826Metamoq's pupilTower Champion 1Body LauncherAlmost Number OneEaster EggTower Champion 2Monocrome Adventurer 18 25.78 81.8
View unlocking history of this single game only
Ziggurat 38 -1 0 0.00 0 0.3337158561Practical lessonsApplied studentSo shiny!A walk in the parkIt's a trap!ElementaryMaster of Magic 38 41.54 100
View unlocking history of this single game only

Beta games

Game # Unlocked achievements Locked achievements
Current best # Points % Next easiest # Points %
Serious Sam Fusion 2017 (beta) 76 -1 0 0.00 0 1.1830741167Serious BeginnerAir ElementI love my ShotgunsEarth ElementCo-op BeginnerFire ElementI love my Rocket Launcher 76 137.81 100
View unlocking history of this single game only
Starbound - Unstable 51 -1 0 0.00 0 1.4771518707Adventurer EventualityCongratulations on Your Graduation!The Simple LifeJust like mum used to make!Not in Front of the Children!Amateur BardBook Club 51 111.42 100
View unlocking history of this single game only

Profile was last updated on April 05, 2018 at 02:37 AM.

Next automatic update on June 16, 2024 at 05:21 PM.

Achievement Stats 1.23-dev
Executed 517 queries
7931.19 KiB memory usage
20 crawler available

Legal notice Privacy
Privacy Policy
Powered by Steam